3L1P: POU protein:DNA complex

POU protein:DNA complex. Determined by X-ray diffraction at 2.8 Å resolution. Released 15 Dec 2010.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Mus musculus
Chains: 4
Atoms: 3,063
Mol. weight: 50.04 kDa
Released: 15 Dec 2010

Explore 3L1P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L1P contains 16 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	2-22	21
α-helix	27-38	12
α-helix	44-51	8
α-helix	57-74	18
α-helix	78-82	5
α-helix	102-109	8
α-helix	120-129	10
α-helix	134-149	16

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	5-22	18
α-helix	27-38	12
α-helix	44-52	9
α-helix	57-74	18
α-helix	78-81	4
α-helix	102-111	10
α-helix	120-129	10
α-helix	134-150	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
POU domain, class 5, transcription factor 1	A, B	protein	155	Mus musculus	P20263 (AlphaFold model)
DNA (5'-d(tpcpcpapcpaptptptpgpapapapgpgpcpapapaptpgpgp*a)-3')	N	DNA	23
DNA (5'-d(aptpcpcpaptptptpgpcpcptptptpcpapapaptpgptpgp*g)-3')	M	DNA	23

Sequence of entity 1 (A, B), FASTA

>3L1P_1 POU domain, class 5, transcription factor 1 (chains A, B)
GAMDMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTISRFEALQLSL
KNMSKLRPLLEKWVEEADNNENLQEISKSETLVQARKRKRTSIENRVRWSLETMFLKSPK
PSLQQITHIANQLGLEKDVVRVWFSNRRQKGKRSS

Sequence of entity 2 (N), FASTA

>3L1P_2 DNA (5'-D(*TP*CP*CP*AP*CP*AP*TP*TP*TP*GP*AP*AP*AP*GP*GP*CP*AP*AP*AP*TP*GP*GP*A)-3') (chains N)
TCCACATTTGAAAGGCAAATGGA

Sequence of entity 3 (M), FASTA

>3L1P_3 DNA (5'-D(*AP*TP*CP*CP*AP*TP*TP*TP*GP*CP*CP*TP*TP*TP*CP*AP*AP*AP*TP*GP*TP*GP*G)-3') (chains M)
ATCCATTTGCCTTTCAAATGTGG

Primary citation

A unique Oct4 interface is crucial for reprogramming to pluripotency. Esch, D., Vahokoski, J., Groves, M.R. et al. Nat Cell Biol (2013) 15:295-301. DOI 10.1038/ncb2680 · PubMed

Other PDB entries of the same protein (UniProt P20263 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8BX1 2.5 Å, Oct4/Sox2 protein:DNA complex
8BX2 3.14 Å, Oct4/Sox2 protein:DNA complex
6HT5 3.45 Å, Oct4/Sox2:UTF1 structure
1OCP Solution structure of OCT3 pou-homeodomain

Browse structure collections

About this viewer

MolViewer shows 3L1P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.