8BX2: Oct4/Sox2 protein:DNA complex

Oct4/Sox2 protein:DNA complex. Determined by X-ray diffraction at 3.14 Å resolution. Released 20 Dec 2023.

Method: X-ray diffraction
Resolution: 3.14 Å
Organism: Mus musculus
Chains: 4
Atoms: 2,298
Mol. weight: 41.56 kDa
Released: 20 Dec 2023

Explore 8BX2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8BX2 contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	2-8	7
α-helix	12-23	12
α-helix	27-38	12
α-helix	44-51	8
α-helix	57-98	42

Chain E: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	3-7	5
α-helix	9-24	16
α-helix	30-42	13
α-helix	46-66	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor SOX-2	E	protein	83	Mus musculus	P48432 (AlphaFold model)
POU domain, class 5, transcription factor 1	A	protein	155	Mus musculus	P20263 (AlphaFold model)
UTF1_r	C	DNA	22	Mus musculus
UTF1_f	D	DNA	22	Mus musculus

Sequence of entity 1 (E), FASTA

>8BX2_1 Transcription factor SOX-2 (chains E)
GAMDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAK
RLRALHMKEHPDYKYRPRRKTKT

Sequence of entity 2 (A), FASTA

>8BX2_2 POU domain, class 5, transcription factor 1 (chains A)
GAMDMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTISRFEALQLSL
KNMSKLRPLLEKWVEEADNNENLQEISKSETLVQARKRKRTSIENRVRWSLETMFLKSPK
PSLQQITHIANQLGLEKDVVRVWFSNRRQKGKRSS

Sequence of entity 3 (C), FASTA

>8BX2_3 UTF1_r (chains C)
ACTCATTGTTATGCTAGTGAAG

Sequence of entity 4 (D), FASTA

>8BX2_4 UTF1_f (chains D)
TCTTCACTAGCATAACAATGAG

Primary citation

Crystal structure of Oct4-Soc2-UTF1 complex. Chojnowski, G., Wilmanns, M., Round, E. To be published.

Other PDB entries of the same protein (UniProt P48432 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8BX1 2.5 Å, Oct4/Sox2 protein:DNA complex
1GT0 2.6 Å, Crystal structure of a POU/HMG/DNA ternary complex
6HT5 3.45 Å, Oct4/Sox2:UTF1 structure

Browse structure collections

About this viewer

MolViewer shows 8BX2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.