Crystal structure of DHT-bound androgen receptor in complex with the first motif of steroid receptor coactivator 3. Determined by X-ray diffraction at 1.55 Å resolution. Released 12 Jan 2010.
Explore 3L3X in 3D Show helices and sheets RCSB PDB PDBe
3L3X contains 12 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 673-680 | 8 | |
| α-helix | 697-720 | 24 | |
| α-helix | 725-727 | 3 | |
| α-helix | 730-757 | 28 | |
| β-strand | 762-765 | 4 | 1 |
| β-strand | 768-770 | 3 | 1 |
| α-helix | 772-777 | 6 | |
| α-helix | 781-796 | 16 | |
| α-helix | 801-811 | 11 | |
| β-strand | 815-817 | 3 | 2 |
| α-helix | 824-841 | 18 | |
| α-helix | 849-882 | 34 | |
| α-helix | 893-901 | 9 | |
| α-helix | 903-907 | 5 | |
| β-strand | 911-913 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 619-626 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Androgen receptor | A | protein | 250 | Homo sapiens | P10275 (AlphaFold model) |
| Nuclear receptor coactivator 3 | B | protein | 12 | Homo sapiens | Q9Y6Q9 (AlphaFold model) |
>3L3X_1 Androgen receptor (chains A) SQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNL HVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMR HLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKN PTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILS GKVKPIYFHT
>3L3X_2 Nuclear receptor coactivator 3 (chains B) HKKLLQLLTCSS
| ID | Name | Formula | Copies |
|---|---|---|---|
| DHT | 5-alpha-dihydrotestosterone | C19 H30 O2 | 1 |
Identification of SRC3/AIB1 as a Preferred Coactivator for Hormone-activated Androgen Receptor. Zhou, X.E., Suino-Powell, K.M., Li, J. et al. J Biol Chem (2010) 285:9161-9171. DOI 10.1074/jbc.M109.085779 · PubMed
Other PDB entries of the same protein (UniProt P10275 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3L3X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.