3L3X: DHT-bound androgen receptor

Crystal structure of DHT-bound androgen receptor in complex with the first motif of steroid receptor coactivator 3. Determined by X-ray diffraction at 1.55 Å resolution. Released 12 Jan 2010.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,369
Mol. weight: 30.8 kDa
Ligands: DHT
Released: 12 Jan 2010

Explore 3L3X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L3X contains 12 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	673-680	8
α-helix	697-720	24
α-helix	725-727	3
α-helix	730-757	28
β-strand	762-765	4	1
β-strand	768-770	3	1
α-helix	772-777	6
α-helix	781-796	16
α-helix	801-811	11
β-strand	815-817	3	2
α-helix	824-841	18
α-helix	849-882	34
α-helix	893-901	9
α-helix	903-907	5
β-strand	911-913	3	2

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	619-626	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Androgen receptor	A	protein	250	Homo sapiens	P10275 (AlphaFold model)
Nuclear receptor coactivator 3	B	protein	12	Homo sapiens	Q9Y6Q9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3L3X_1 Androgen receptor (chains A)
SQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNL
HVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMR
HLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKN
PTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILS
GKVKPIYFHT

Sequence of entity 2 (B), FASTA

>3L3X_2 Nuclear receptor coactivator 3 (chains B)
HKKLLQLLTCSS

Ligands and cofactors

ID	Name	Formula	Copies
DHT	5-alpha-dihydrotestosterone	C19 H30 O2	1

Primary citation

Identification of SRC3/AIB1 as a Preferred Coactivator for Hormone-activated Androgen Receptor. Zhou, X.E., Suino-Powell, K.M., Li, J. et al. J Biol Chem (2010) 285:9161-9171. DOI 10.1074/jbc.M109.085779 · PubMed

Other PDB entries of the same protein (UniProt P10275 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8E1A 1.2 Å, Structure-based study to overcome cross-reactivity of novel androgen receptor inhibitors
7ZTZ 1.4 Å, Crystal structure of mutant AR-LBD (Y764C) bound to dihydrotestosterone
4OHA 1.42 Å, Crystal structure of T877A-AR-LBD bound with co-regulator peptide
5V8Q 1.44 Å, Synthesis and biological evaluation of novel selective androgen receptor modulators…
2AX6 1.5 Å, Crystal Structure Of The Androgen Receptor Ligand Binding Domain T877A Mutant In Complex…
8FH0 1.59 Å, Crystal structure of mutant Androgen Receptor ligand binding domain H875Y/F877L/T878A…
8FH2 1.59 Å, Crystal structure of mutant Androgen Receptor ligand binding domain L702H/H875Y with DHT
8FGZ 1.61 Å, Crystal structure of mutant Androgen Receptor ligand binding domain L702H/H875Y/F877L…
2AM9 1.64 Å, Crystal structure of human androgen receptor ligand binding domain in complex with…
2AX9 1.65 Å, Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With R-3
2PNU 1.65 Å, Crystal structure of human androgen receptor ligand-binding domain in complex with EM-5744
3B66 1.65 Å, Crystal structure of the androgen receptor ligand binding domain in complex with SARM S-21

Browse structure collections

About this viewer

MolViewer shows 3L3X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.