3L42: Peregrin

PWWP domain of human bromodomain and PHD finger containing protein 1. Determined by X-ray diffraction at 1.3 Å resolution. Released 12 Jan 2010.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,168
Mol. weight: 15.08 kDa
Released: 12 Jan 2010

Explore 3L42 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L42 contains 6 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1088-1091	4	1
β-strand	1099-1104	6	1
β-strand	1113-1115	3	2
β-strand	1118-1120	3	2
α-helix	1121-1124	4
α-helix	1125-1137	13
α-helix	1141	1
β-strand	1142-1147	6	1
β-strand	1154-1158	5	1
α-helix	1159-1161	3
β-strand	1162-1164	3	1
α-helix	1169-1176	8
α-helix	1182-1202	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peregrin	A	protein	130	Homo sapiens	P55201 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3L42_1 Peregrin (chains A)
GEDSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQE
AREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQ
HRSKVQGEQS

Primary citation

Structural and Histone Binding Ability Characterizations of Human PWWP Domains. Wu, H., Zeng, H., Lam, R. et al. PLoS One (2011) 6:e18919-e18919. DOI 10.1371/journal.pone.0018919 · PubMed

Other PDB entries of the same protein (UniProt P55201 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MWZ 1.25 Å, Crystal structure of the human BRPF1 bromodomain in complex with BZ073
5C6S 1.3 Å, Human Bromodomain and PHD Finger Containing 1, PWWP domain in complex with XST005904a
5FFV 1.3 Å, Crystal structure of the bromodomain of human BRPF1 in complex with H3K14ac histone…
5O5F 1.3 Å, Crystal structure of the human BRPF1 bromodomain in complex with BZ038
5ETB 1.33 Å, Crystal structure of the human BRPF1 bromodomain in complex with SEED13
5D7X 1.35 Å, Crystal structure of the human BRPF1 bromodomain in complex with XZ08
7C4I 1.37 Å, High resolution structure of BRPF1 Bromo Domain from Biortus
5EM3 1.4 Å, Crystal structure of the human BRPF1 bromodomain in complex with SEED9
5ETD 1.4 Å, Crystal structure of the human BRPF1 bromodomain in complex with SEED14
8QAZ 1.4 Å, Crystal Structure of BRPF1 bromodomain in complex with acetyl-pyrrole derivative…
8QB2 1.42 Å, Crystal Structure of BRPF1 bromodomain in complex with acetyl-pyrrole derivative…
5EV9 1.45 Å, Crystal structure of the human BRPF1 bromodomain in complex with SEED15

Browse structure collections

About this viewer

MolViewer shows 3L42 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.