Crystal structure of the human BRPF1 bromodomain in complex with SEED9. Determined by X-ray diffraction at 1.4 Å resolution. Released 8 Jun 2016.
Explore 5EM3 in 3D Show helices and sheets RCSB PDB PDBe
5EM3 contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 630-647 | 18 | |
| α-helix | 665-668 | 4 | |
| α-helix | 675-683 | 9 | |
| α-helix | 690-707 | 18 | |
| α-helix | 713-737 | 25 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peregrin | A | protein | 116 | Homo sapiens | P55201 (AlphaFold model) |
>5EM3_1 Peregrin (chains A) SMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEA YRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG
| ID | Name | Formula | Copies |
|---|---|---|---|
| 5Q0 | quinolin-5-ol | C9 H7 N O | 2 |
Water and common crystallization additives (NO3) are not listed.
Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions. Zhu, J., Caflisch, A. J Med Chem (2016) 59:5555-5561. DOI 10.1021/acs.jmedchem.6b00215 · PubMed
Other PDB entries of the same protein (UniProt P55201 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5EM3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.