5C6S: Peregrin

Human Bromodomain and PHD Finger Containing 1, PWWP domain in complex with XST005904a. Determined by X-ray diffraction at 1.3 Å resolution. Released 29 Jul 2015.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,373
Mol. weight: 15.52 kDa
Ligands: 4K8
Released: 29 Jul 2015

Explore 5C6S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5C6S contains 6 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1088-1091	4	1
β-strand	1099-1104	6	1
β-strand	1113-1115	3	2
β-strand	1118-1120	3	2
α-helix	1121-1124	4
α-helix	1125-1137	13
α-helix	1141	1
β-strand	1142-1147	6	1
β-strand	1154-1158	5	1
α-helix	1159-1161	3
β-strand	1162-1164	3	1
α-helix	1169-1176	8
α-helix	1182-1202	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peregrin	A	protein	130	Homo sapiens	P55201 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5C6S_1 Peregrin (chains A)
GEDSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQE
AREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQ
HRSKVQGEQS

Ligands and cofactors

ID	Name	Formula	Copies
4K8	isoquinoline-3-carboxylic acid	C10 H7 N O2	1

Water and common crystallization additives (UNX, EPE, CL) are not listed.

Primary citation

Human Bromodomain and PHD Finger Containing 1, PWWP domain in complex with XST005904a. DOBROVETSKY, E., DONG, A., MADER, P. et al. To be published.

Other PDB entries of the same protein (UniProt P55201 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MWZ 1.25 Å, Crystal structure of the human BRPF1 bromodomain in complex with BZ073
3L42 1.3 Å, PWWP domain of human bromodomain and PHD finger containing protein 1
5FFV 1.3 Å, Crystal structure of the bromodomain of human BRPF1 in complex with H3K14ac histone…
5O5F 1.3 Å, Crystal structure of the human BRPF1 bromodomain in complex with BZ038
5ETB 1.33 Å, Crystal structure of the human BRPF1 bromodomain in complex with SEED13
5D7X 1.35 Å, Crystal structure of the human BRPF1 bromodomain in complex with XZ08
7C4I 1.37 Å, High resolution structure of BRPF1 Bromo Domain from Biortus
5EM3 1.4 Å, Crystal structure of the human BRPF1 bromodomain in complex with SEED9
5ETD 1.4 Å, Crystal structure of the human BRPF1 bromodomain in complex with SEED14
8QAZ 1.4 Å, Crystal Structure of BRPF1 bromodomain in complex with acetyl-pyrrole derivative…
8QB2 1.42 Å, Crystal Structure of BRPF1 bromodomain in complex with acetyl-pyrrole derivative…
5EV9 1.45 Å, Crystal structure of the human BRPF1 bromodomain in complex with SEED15

Browse structure collections

About this viewer

MolViewer shows 5C6S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.