High resolution open MthK pore structure crystallized in 100 mM K+. Determined by X-ray diffraction at 1.45 Å resolution. Released 11 Aug 2010.
Explore 3LDC in 3D Show helices and sheets RCSB PDB PDBe
3LDC contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 20-42 | 23 | |
| α-helix | 46-57 | 12 | |
| α-helix | 70-98 | 29 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calcium-gated potassium channel mthK | A | protein | 82 | Methanothermobacter thermautotrophicus | O27564 (AlphaFold model) |
>3LDC_1 Calcium-gated potassium channel mthK (chains A) VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTC TLIVLGIGTFAVAVERLLEFLI
Novel insights into K(+) selectivity from high-resolution structures of an open K(+) channel pore. Ye, S., Li, Y., Jiang, Y. Nat Struct Mol Biol (2010) 17:1019-1023. DOI 10.1038/nsmb.1865 · PubMed
Other PDB entries of the same protein (UniProt O27564 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3LDC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.