3LF4: Fluorescent Timer Precursor Blue102

Crystal Structure of Fluorescent Timer Precursor Blue102. Determined by X-ray diffraction at 1.81 Å resolution. Released 9 Mar 2010.

Method: X-ray diffraction
Resolution: 1.81 Å
Organism: Discosoma sp.
Chains: 2
Atoms: 2,168
Mol. weight: 26.34 kDa
Released: 9 Mar 2010

Explore 3LF4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LF4 contains 7 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	12-22	11	1
β-strand	25-36	12	1
β-strand	41-50	10	1
α-helix	52	1
α-helix	54	1
α-helix	58-60	3
α-helix	62-64	3

Chain B: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	70-72	3
β-strand	74	1	1
α-helix	82-85	4
β-strand	91-99	9	1
β-strand	104-114	11	1
β-strand	117-127	11	1
β-strand	140-143	4	1
β-strand	146-153	8	1
β-strand	156-167	12	1
β-strand	171-183	13	1
α-helix	188-190	3
β-strand	193-204	12	1
β-strand	210-221	12	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fluorescent Timer Precursor Blue102	A	protein	66	Discosoma sp.	D1MPT3 (AlphaFold model)
Fluorescent Timer Precursor Blue102	B	protein	164	Discosoma sp.	D1MPT3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3LF4_1 Fluorescent Timer Precursor Blue102 (chains A)
EEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDI
LSPQFL

Sequence of entity 2 (B), FASTA

>3LF4_2 Fluorescent Timer Precursor Blue102 (chains B)
XSRAYVKHPADIPDYWKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGT
NFPSDGPVMQKKTMGWEAISERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPV
QLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Primary citation

Understanding blue-to-red conversion in monomeric fluorescent timers and hydrolytic degradation of their chromophores. Pletnev, S., Subach, F.V., Dauter, Z. et al. J Am Chem Soc (2010) 132:2243-2253. DOI 10.1021/ja908418r · PubMed

Other PDB entries of the same protein (UniProt D1MPT3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NED 0.95 Å, mRouge
6MZ3 1.09 Å, mCherry pH sensitive mutant - M66T (mCherryTYG)
3LF3 1.15 Å, Crystal Structure of Fast Fluorescent Timer Fast-FT
7SAK 1.15 Å, Crystal Structure of LaM4 Nanobody bound to mCherry
31AL 1.5 Å, Synchrotron structure of non-photoactivated PAmCherry1
3KCS 1.5 Å, Crystal structure of PAmCherry1 in the dark state
9FEL 1.5 Å, LSSmCherry1 - Directionality of Optical Properties of Fluorescent Proteins
6YLM 1.6 Å, mCherry
31JT 1.63 Å, SFX structure of non-photoactivated PAmCherry1
3KCT 1.65 Å, CRYSTAL STRUCTURE OF PAmCherry1 in the photoactivated state
3NEZ 1.7 Å, mRojoA
5H89 1.76 Å, Crystal structure of mRojoA mutant - T16V - P63Y - W143G - L163V

Browse structure collections

About this viewer

MolViewer shows 3LF4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.