3LLU: Ras-related GTP-binding protein C

Crystal structure of the nucleotide-binding domain of Ras-related GTP-binding protein C. Determined by X-ray diffraction at 1.4 Å resolution. Released 9 Feb 2010.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,643
Mol. weight: 23.44 kDa
Ligands: MG, GNP
Released: 9 Feb 2010

Explore 3LLU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LLU contains 8 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	63-68	6	1
α-helix	74-82	9
α-helix	87-92	6
α-helix	93-96	4
β-strand	100-104	5	1
β-strand	112-116	5	1
α-helix	130-135	6
β-strand	139-145	7	1
α-helix	151-167	17
β-strand	172-178	7	1
α-helix	180-182	3
α-helix	185-205	21
β-strand	213-218	6	1
α-helix	224-235	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related GTP-binding protein C	A	protein	196	Homo sapiens	Q9HB90 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3LLU_1 Ras-related GTP-binding protein C (chains A)
MHHHHHHSSGRENLYFQGSKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIYK
DDISNSSFVNFQIWDFPGQMDFFDPTFDYEMIFRGTGALIYVIDAQDDYMEALTRLHITV
SKAYKVNPDMNFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKLHLSFYLTSIY
DHSIFEAFSKVVQKLI

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	1

Water and common crystallization additives (UNX) are not listed.

Primary citation

Crystal structure of the nucleotide-binding domain of Ras-related GTP-binding protein C. Nedyalkova, L., Tempel, W., Tong, Y. et al. To be published.

Other PDB entries of the same protein (UniProt Q9HB90 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S6D 2.5 Å, Crystal structure of RagA-Q66L-GTP/RagC-S75N-GDP GTPase heterodimer complex
6S6A 2.63 Å, Crystal structure of RagA-Q66L/RagC-T90N GTPase heterodimer complex
6EHR 2.9 Å, The crystal structure of the human LAMTOR-RagA CTD-RagC CTD complex
7UX2 2.9 Å, cryo-EM structure of the Raptor-TFEB-Rag-Ragulator complex
6U62 3.18 Å, Raptor-Rag-Ragulator complex
6WJ2 3.2 Å, CryoEM structure of the SLC38A9-RagA-RagC-Ragulator complex in the pre-GAP state
7UXC 3.2 Å, cryo-EM structure of the mTORC1-TFEB-Rag-Ragulator complex with symmetry expansion
7UXH 3.2 Å, cryo-EM structure of the mTORC1-TFEB-Rag-Ragulator complex
9ED4 3.23 Å, A composite map of mTORC1-Rag-Ragultor-4EBP1 on membrane
6ULG 3.31 Å, Cryo-EM structure of the FLCN-FNIP2-Rag-Ragulator complex
8DHB 3.53 Å, Active FLCN GAP complex
6NZD 3.6 Å, Cryo-EM Structure of the Lysosomal Folliculin Complex (FLCN-FNIP2-RagA-RagC-Ragulator)

Browse structure collections

About this viewer

MolViewer shows 3LLU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.