3LMK: Metabotropic glutamate receptor 5

Ligand Binding Domain of Metabotropoc glutamate receptor mGluR5 complexed with glutamate. Determined by X-ray diffraction at 2.44 Å resolution. Released 16 Feb 2010.

Method: X-ray diffraction
Resolution: 2.44 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,884
Mol. weight: 111.69 kDa
Ligands: NAG, GLU, MG
Released: 16 Feb 2010

Explore 3LMK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LMK contains 41 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	29-31	3	1
β-strand	35-41	7	1
β-strand	44	1	2
α-helix	45-47	3
β-strand	60	1	2
α-helix	62-66	5
α-helix	67-81	15
α-helix	89-90	2
β-strand	91-97	7	1
α-helix	102-112	11
β-strand	143-147	5	1
α-helix	152-162	11
α-helix	163-165	3
β-strand	169-171	3	1
α-helix	177-180	4
β-strand	188-190	3	1
α-helix	195-208	14
β-strand	213-219	7	3
α-helix	222-235	14
β-strand	241-248	8	3
α-helix	254-267	14
β-strand	273-277	5	3
β-strand	279	1	4
α-helix	280-293	14
β-strand	300-303	4	3
β-strand	306	1	4
α-helix	311-314	4
α-helix	318-321	4
β-strand	325-329	5	3
α-helix	335-342	8
α-helix	355-363	9
β-strand	366	1	5
α-helix	379	1
β-strand	380	1	5
α-helix	381-382	2
α-helix	397-418	22
α-helix	427-429	3
α-helix	434-441	8
β-strand	445-447	3	6
α-helix	452	1
β-strand	453-455	3	6
β-strand	466-473	8	3
β-strand	479-488	10	3
β-strand	491-494	4	3

Chain B: 19 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	29-31	3	7
β-strand	35-41	7	7
β-strand	44	1	8
α-helix	45-48	4
β-strand	60	1	8
α-helix	62-66	5
α-helix	67-81	15
β-strand	91-97	7	7
α-helix	102-112	11
β-strand	143-147	5	7
α-helix	152-162	11
α-helix	163-165	3
β-strand	169-171	3	7
α-helix	177-180	4
β-strand	188-190	3	7
α-helix	195-208	14
β-strand	213-219	7	9
α-helix	222-237	16
β-strand	241-248	8	9
α-helix	254-265	12
β-strand	273-277	5	9
α-helix	280-292	13
β-strand	300-303	4	9
α-helix	311-314	4
α-helix	318-321	4
β-strand	325-329	5	9
α-helix	332-334	3
α-helix	335-341	7
α-helix	355-363	9
β-strand	366	1	10
β-strand	380	1	10
α-helix	397-418	22
α-helix	427-429	3
α-helix	434-442	9
β-strand	445-447	3	11
β-strand	453-455	3	11
β-strand	466-473	8	9
β-strand	479-488	10	9
β-strand	491-494	4	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Metabotropic glutamate receptor 5	A, B	protein	492	Homo sapiens	P41594 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3LMK_1 Metabotropic glutamate receptor 5 (chains A, B)
GAMDGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVEAML
HTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGS
SSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVP
SDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGISIAHSYKIYSNAG
EQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFLLLGSDGWADRYDV
TDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQHRFQCRLEGFPQE
NSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCPGYAGLCDAMKPID
GRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFDYINVGSWDNGELK
MDDDEVWSKKSN

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2
GLU	Glutamic acid	C5 H9 N O4	2
MG	Magnesium ion	Mg	3

Primary citation

Metabotropic Glutamate receptor mGluR5 complexed with glutamate. Dobrovetsky, E., Khutoreskaya, G., Seitova, A. et al. To be published.

Other PDB entries of the same protein (UniProt P41594 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6FFI 2.2 Å, Crystal Structure of mGluR5 in complex with MMPEP at 2.2 A
9HC0 2.33 Å, Dark structure of the human metabotropic glutamate receptor 5 transmembrane domain bound…
7P2L 2.54 Å, thermostabilised 7TM domain of human mGlu5 receptor bound to photoswitchable ligand…
4OO9 2.6 Å, Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane…
5CGD 2.6 Å, Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane…
6FFH 2.65 Å, Crystal Structure of mGluR5 in complex with Fenobam at 2.65 A
8TAO 2.9 Å, Quis and CDPPB bound active mGlu5
9HC3 2.9 Å, Apo-state structure of the human metabotropic glutamate receptor 5 transmembrane domain…
8T8M 3.0 Å, Quis-bound intermediate mGlu5
8X0G 3.0 Å, Human FL Metabotropic glutamate receptor 5, mGlu5-5M with quisqualate, Acc conformation…
8X0B 3.1 Å, Human FL Metabotropic glutamate receptor 5, mGlu5-5M with Quisqualate and VU0424465
5CGC 3.1 Å, Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane…

Browse structure collections

About this viewer

MolViewer shows 3LMK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.