8T8M: Quis-bound intermediate mGlu5

Quis-bound intermediate mGlu5. Determined by electron microscopy at 3.0 Å resolution. Released 11 Oct 2023.

Method: Electron microscopy
Resolution: 3.0 Å
Organisms: Homo sapiens, Lama glama
Chains: 4
Atoms: 13,146
Mol. weight: 224.82 kDa
Ligands: QUS
Released: 11 Oct 2023

Explore 8T8M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8T8M contains 59 α-helices and 84 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	29-31	3	1
β-strand	35-41	7	1
β-strand	44	1	2
α-helix	45-48	4
β-strand	60	1	2
α-helix	62-66	5
α-helix	67-79	13
β-strand	91-97	7	1
α-helix	102-112	11
β-strand	143-147	5	1
α-helix	152-162	11
α-helix	163-165	3
β-strand	169-171	3	1
α-helix	178-180	3
β-strand	188-190	3	1
α-helix	196-207	12
α-helix	208-210	3
β-strand	215-219	5	3
α-helix	223-236	14
β-strand	245-248	4	3
α-helix	254-264	11
α-helix	265-267	3
β-strand	273-277	5	3
α-helix	280-292	13
β-strand	300-303	4	3
β-strand	325-329	5	3
α-helix	335-341	7
α-helix	355-363	9
β-strand	366	1	4
β-strand	380	1	4
α-helix	381-382	2
α-helix	397-415	19
α-helix	434-441	8
β-strand	445-447	3	5
β-strand	453-455	3	5
β-strand	461	1	1
β-strand	466-473	8	3
β-strand	479-488	10	3
β-strand	491-494	4	3
α-helix	505-508	4
β-strand	520-524	5	6
β-strand	532-536	5	6
β-strand	541-545	5	7
β-strand	548-551	4	7
β-strand	558	1	8
β-strand	565	1	8
α-helix	569-571	3
α-helix	578-603	26
α-helix	610-612	3
α-helix	615-636	22
α-helix	641-668	28
α-helix	693-714	22
β-strand	719-722	4	9
β-strand	730-733	4	9
α-helix	741-760	20
α-helix	770-792	23
α-helix	801-825	25

Chain B: 26 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	29-31	3	10
β-strand	35-41	7	10
β-strand	44	1	11
α-helix	45-48	4
β-strand	60	1	11
α-helix	67-80	14
β-strand	91-97	7	10
α-helix	102-114	13
β-strand	143-147	5	10
α-helix	152-164	13
β-strand	169-171	3	10
β-strand	188-190	3	10
α-helix	196-208	13
β-strand	214-219	6	12
α-helix	222-238	17
β-strand	242-248	7	12
α-helix	254-265	12
β-strand	273-276	4	12
α-helix	280-293	14
β-strand	300-303	4	12
α-helix	319-321	3
β-strand	325-329	5	12
α-helix	335-341	7
α-helix	355-363	9
β-strand	366	1	13
β-strand	380	1	13
α-helix	381-382	2
α-helix	397-418	22
α-helix	427-429	3
α-helix	432-433	2
α-helix	434-441	8
β-strand	445-447	3	14
β-strand	453-455	3	14
β-strand	466-473	8	12
β-strand	479-488	10	12
β-strand	491-494	4	12
α-helix	496-499	4
α-helix	505-507	3
β-strand	520-524	5	15
β-strand	532-536	5	15
β-strand	541-542	2	16
β-strand	550-551	2	16
β-strand	558	1	17
β-strand	565	1	17
β-strand	571	1	18
α-helix	578-603	26
α-helix	610-612	3
α-helix	615-633	19
α-helix	641-668	28
α-helix	690-714	25
β-strand	719-722	4	18
β-strand	730-733	4	18
α-helix	737-760	24
α-helix	770-792	23
α-helix	801-825	25

Chain C: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	6-9	4	19
β-strand	13-15	3	20
β-strand	20-26	7	19
α-helix	31-33	3
β-strand	35-41	7	21
β-strand	48-53	6	21
β-strand	55	1	22
β-strand	57	1	22
β-strand	60-62	3	21
β-strand	70-75	6	19
β-strand	80-85	6	19
α-helix	90-92	3
β-strand	94-101	8	21
β-strand	112-114	3	21
β-strand	116	1	19
β-strand	119-121	3	21
β-strand	122-124	3	20

Chain D: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	23
β-strand	12-15	4	24
β-strand	19-27	9	23
α-helix	31-33	3
β-strand	35-41	7	24
β-strand	47-53	7	24
β-strand	60-62	3	24
α-helix	64-66	3
β-strand	71-75	5	23
β-strand	80-86	7	23
α-helix	90-92	3
β-strand	94-101	8	24
β-strand	112-114	3	24
β-strand	119-124	6	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Metabotropic glutamate receptor 5	A, B	protein	881	Homo sapiens	P41594 (AlphaFold model)
Nb43	C, D	protein	123	Lama glama

Sequence of entity 1 (A, B), FASTA

>8T8M_1 Metabotropic glutamate receptor 5 (chains A, B)
MKTIIALSYIFCLVFADYKDDDDAAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHER
KCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRD
SLISSEEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSAT
SMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMS
AKEGICIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGL
AGEFLLLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWF
QEFWQHRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQ
MSLCPGYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMG
KDYFDYINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCT
PCKENEYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATL
FVTVVFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSP
AMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIME
PPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIA
FTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRS
AFTTSTVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETL

Sequence of entity 2 (C, D), FASTA

>8T8M_2 Nb43 (chains C, D)
QVQLVESGGGLVQAGGSLRLSCAASGRTFTSYAMGWFRQAPGKERESVAAISSSGGSTHY
ADSVKGRFTISRDNSKNTVYLQMNSLKPEDTAVYYCAAAMYGSRWPDWEYDYWGQGTQVT
VSS

Ligands and cofactors

ID	Name	Formula	Copies
QUS	(s)-2-amino-3-(3,5-dioxo-[1,2,4]OXADIAZOLIDIN-2-yl)-propionic acid	C5 H7 N3 O5	2

Primary citation

Stepwise activation of a metabotropic glutamate receptor. Krishna Kumar, K., Wang, H., Habrian, C. et al. Nature (2024) 629:951-956. DOI 10.1038/s41586-024-07327-x · PubMed

Other PDB entries of the same protein (UniProt P41594 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6FFI 2.2 Å, Crystal Structure of mGluR5 in complex with MMPEP at 2.2 A
9HC0 2.33 Å, Dark structure of the human metabotropic glutamate receptor 5 transmembrane domain bound…
3LMK 2.44 Å, Ligand Binding Domain of Metabotropoc glutamate receptor mGluR5 complexed with glutamate
7P2L 2.54 Å, thermostabilised 7TM domain of human mGlu5 receptor bound to photoswitchable ligand…
4OO9 2.6 Å, Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane…
5CGD 2.6 Å, Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane…
6FFH 2.65 Å, Crystal Structure of mGluR5 in complex with Fenobam at 2.65 A
8TAO 2.9 Å, Quis and CDPPB bound active mGlu5
9HC3 2.9 Å, Apo-state structure of the human metabotropic glutamate receptor 5 transmembrane domain…
8X0G 3.0 Å, Human FL Metabotropic glutamate receptor 5, mGlu5-5M with quisqualate, Acc conformation…
8X0B 3.1 Å, Human FL Metabotropic glutamate receptor 5, mGlu5-5M with Quisqualate and VU0424465
5CGC 3.1 Å, Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane…

Browse structure collections

About this viewer

MolViewer shows 8T8M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.