6FFI: MGluR5

Crystal Structure of mGluR5 in complex with MMPEP at 2.2 A. Determined by X-ray diffraction at 2.2 Å resolution. Released 7 Mar 2018.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Homo sapiens, Enterobacteria phage T4
Chains: 1
Atoms: 3,492
Mol. weight: 52.26 kDa
Ligands: OLA, D8B
Released: 7 Mar 2018

Explore 6FFI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FFI contains 21 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	569-574	6
α-helix	579-603	25
α-helix	604-606	3
α-helix	608-611	4
α-helix	615-630	16
α-helix	632-635	4
β-strand	636	1	1
α-helix	641-687	47
β-strand	691-692	2	2
β-strand	693	1	3
β-strand	694-696	3	2
β-strand	702-705	4	2
β-strand	708-709	2	2
α-helix	716-727	12
β-strand	734	1	3
α-helix	737-756	20
α-helix	762-767	6
α-helix	770-788	19
α-helix	792-799	8
α-helix	803-810	8
α-helix	814-818	5
α-helix	820-832	13
α-helix	850-874	25
β-strand	879	1	4
β-strand	890	1	1
β-strand	893	1	4
α-helix	897-920	24
α-helix	926-953	28
α-helix	958-973	16
α-helix	974-978	5
α-helix	979-987	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Metabotropic glutamate receptor 5,Endolysin,Metabotropic glutamate receptor 5	A	protein	444	Homo sapiens, Enterobacteria phage T4	P00720, P41594 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6FFI_1 Metabotropic glutamate receptor 5,Endolysin,Metabotropic glutamate receptor 5 (chains A)
AASPVQYLRWGDPAPIAAVVFACLGLLATLFVTVVFIIYRDTPVVKSSSRELCYIILAGI
CLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTYRAARILAMSKKNIFEMLR
IDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFN
QDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDE
AAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKICTKKPRFMSACAQLVIAFILICIQL
GIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVAPLGYNGLLILACTFYAFKTRNVP
ANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYII
LAKPERNVRSAAAAHHHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
OLA	Oleic acid	C18 H34 O2	7
D8B	2-[2-(3-methoxyphenyl)ethynyl]-6-methyl-pyridine	C15 H13 N O	1

Water and common crystallization additives (MES) are not listed.

Primary citation

Structure-Based Optimization Strategies for G Protein-Coupled Receptor (GPCR) Allosteric Modulators: A Case Study from Analyses of New Metabotropic Glutamate Receptor 5 (mGlu5) X-ray Structures. Christopher, J.A., Orgovan, Z., Congreve, M. et al. J Med Chem (2019) 62:207-222. DOI 10.1021/acs.jmedchem.7b01722 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse structure collections

About this viewer

MolViewer shows 6FFI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.