3LQH: MLL1 PHD3-Bromo in the free form

Crystal structure of MLL1 PHD3-Bromo in the free form. Determined by X-ray diffraction at 1.72 Å resolution. Released 7 Jul 2010.

Method: X-ray diffraction
Resolution: 1.72 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,571
Mol. weight: 21.44 kDa
Ligands: ZN
Released: 7 Jul 2010

Explore 3LQH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LQH contains 9 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	1568	1	1
β-strand	1575	1	1
β-strand	1585-1587	3	2
β-strand	1594-1596	3	2
α-helix	1597-1599	3
α-helix	1604-1612	9
α-helix	1614-1617	4
α-helix	1631-1652	22
α-helix	1655-1661	7
α-helix	1708-1716	9
α-helix	1723-1740	18
α-helix	1745-1765	21
α-helix	1771-1773	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone-lysine N-methyltransferase MLL	A	protein	183	Homo sapiens	Q03164

Sequence of entity 1 (A), FASTA

>3LQH_1 Histone-lysine N-methyltransferase MLL (chains A)
SGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNC
TERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQQQPLDLEGVKRKMDQGNYT
SVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNK
VSS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Pro isomerization in MLL1 PHD3-bromo cassette connects H3K4me readout to CyP33 and HDAC-mediated repression. Wang, Z., Song, J., Milne, T.A. et al. Cell (2010) 141:1183-1194. DOI 10.1016/j.cell.2010.05.016 · PubMed

Other PDB entries of the same protein (UniProt Q03164), best resolution first:

3EMH 1.37 Å, Structural basis of WDR5-MLL interaction
9C4T 1.46 Å, menin mutant M327I in complex with MLL peptide
9C4V 1.47 Å, Menin mutant G331D in complex with MLL peptide
7S79 1.53 Å, Structure of HLA-B*07:02 in complex with synthetic phosphono-mll peptide analog
9C4S 1.54 Å, Menin mutant G331R in complex with MLL peptide
4GQ6 1.55 Å, Human menin in complex with MLL peptide
7S7D 1.56 Å, Structure of HLA-B*07:02 in complex with synthetic sulfo-mll peptide analog
9C4U 1.57 Å, Menin mutant T349M in complex with MLL peptide
7S8E 1.6 Å, Structure of HLA-B*07:02 in complex with MLL(747-755) phosphopeptide and bound glycerol
4ESG 1.7 Å, X-ray structure of WDR5-MLL1 Win motif peptide binary complex
3EG6 1.72 Å, Structure of WDR5 bound to MLL1 peptide
7RZJ 1.8 Å, Crystal structure of HLA-B*07:02 in complex with MLL(747-755) phosphopeptide

Browse structure collections

About this viewer

MolViewer shows 3LQH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.