3LWE: MPP8

The crystal structure of MPP8. Determined by X-ray diffraction at 2.05 Å resolution. Released 2 Mar 2010.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,062
Mol. weight: 14.69 kDa
Released: 2 Mar 2010

Explore 3LWE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LWE contains 6 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	6-15	10	1
β-strand	18-25	8	1
α-helix	30-32	3
β-strand	34-37	4	1
α-helix	38-41	4
α-helix	45-59	15

Chain B: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	6-15	10	2
β-strand	18-25	8	2
α-helix	30-32	3
β-strand	34-37	4	2
α-helix	38-41	4
α-helix	45-57	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
M-phase phosphoprotein 8	A, B	protein	62	Homo sapiens	Q99549 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3LWE_1 M-phase phosphoprotein 8 (chains A, B)
GEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENK
AK

Primary citation

Structural basis for specific binding of human MPP8 chromodomain to histone H3 methylated at lysine 9. Li, J., Li, Z., Ruan, J. et al. PLoS One (2011) 6:e25104-e25104. DOI 10.1371/journal.pone.0025104 · PubMed

Other PDB entries of the same protein (UniProt Q99549 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6V2S 1.6 Å, Crystal Structure of chromodomain of MPP8 in complex with inhibitor UNC3866
9H77 2.01 Å, MPP8 chromodomain in complex with nanobody 3A02
7M5U 2.02 Å, Crystal structure of human MPP8 chromodomain in complex with peptidomimetic ligand UNC5246
3R93 2.06 Å, Crystal structure of the chromo domain of M-phase phosphoprotein 8 bound to H3K9Me3…
3SVM 2.31 Å, Human MPP8 - human DNMT3AK47me2 peptide
3QO2 2.49 Å, Structural insights for MPP8 chromodomain interaction with histone H3 lysine 9
8QFB 3.04 Å, Crystal structure of human MPP8 C-terminal region (residues 565-860)

Browse structure collections

About this viewer

MolViewer shows 3LWE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.