Crystal structure of Staphylococcal nuclease variant Delta+PHS D21N at cryogenic temperature. Determined by X-ray diffraction at 1.5 Å resolution. Released 16 Feb 2011.
Explore 3LX0 in 3D Show helices and sheets RCSB PDB PDBe
3LX0 contains 7 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| β-strand | 10-12 | 3 | 1 |
| β-strand | 13-19 | 7 | 2 |
| β-strand | 22-27 | 6 | 2 |
| β-strand | 30-36 | 7 | 2 |
| β-strand | 39-40 | 2 | 3 |
| α-helix | 41-43 | 3 | |
| α-helix | 55-67 | 13 | |
| β-strand | 72-75 | 4 | 1 |
| β-strand | 82 | 1 | 2 |
| β-strand | 88-90 | 3 | 2 |
| β-strand | 91-94 | 4 | 1 |
| β-strand | 97-98 | 2 | 1 |
| α-helix | 99-105 | 7 | |
| β-strand | 110-111 | 2 | 3 |
| α-helix | 116-118 | 3 | |
| α-helix | 122-134 | 13 | |
| α-helix | 138-140 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thermonuclease | A | protein | 143 | Staphylococcus aureus | P00644 (AlphaFold model) |
>3LX0_1 Thermonuclease (chains A) ATSTKKLHKEPATLIKAIDGNTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMV ENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR KAEAQAKKEKLNIWSEDNADSGQ
Cooperative Proton Binding in a Cluster of Carboxylic Residues. Doctrow, B.M., Schlessman, J.L., Garcia-Moreno, E.B. et al. To be published.
Other PDB entries of the same protein (UniProt P00644 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3LX0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.