Crystal structure of Staphylococcal nuclease variant Delta+NVIAGLA V23E at cryogenic temperature. Determined by X-ray diffraction at 1.4 Å resolution. Released 14 Sept 2011.
Explore 3TME in 3D Show helices and sheets RCSB PDB PDBe
3TME contains 5 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-15 | 7 | 1 |
| α-helix | 21-23 | 3 | |
| β-strand | 24-27 | 4 | 1 |
| β-strand | 30-32 | 3 | 1 |
| β-strand | 34-36 | 3 | 2 |
| β-strand | 39-40 | 2 | 3 |
| α-helix | 55-67 | 13 | |
| β-strand | 72-75 | 4 | 1 |
| β-strand | 82 | 1 | 2 |
| β-strand | 88-90 | 3 | 2 |
| β-strand | 91-94 | 4 | 1 |
| β-strand | 97-98 | 2 | 1 |
| α-helix | 99-105 | 7 | |
| β-strand | 110-111 | 2 | 3 |
| α-helix | 122-134 | 13 | |
| α-helix | 138-140 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thermonuclease | A | protein | 143 | Staphylococcus aureus | P00644 (AlphaFold model) |
>3TME_1 Thermonuclease (chains A) ATSTKKLHKEPATLIKAIDGNTEKLMYKGQPMVFRLLLVDIPEFNEKYGPEAAAFTKKMV ENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR KAEAQAKKEKLNIWSEDNADSGQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| MRD | (4R)-2-methylpentane-2,4-diol | C6 H14 O2 | 1 |
| THP | Thymidine-3',5'-diphosphate | C10 H16 N2 O11 P2 | 1 |
Crystal structure of Staphylococcal nuclease variant Delta+NVIAGLA V23E at cryogenic temperature. Robinson, A.C., Schlessman, J.L., Majumdar, A. et al. To be published.
Other PDB entries of the same protein (UniProt P00644 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3TME directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.