3M48: GCN4 Leucine Zipper Peptide Mutant
GCN4 Leucine Zipper Peptide Mutant. Determined by X-ray diffraction at 1.45 Å resolution. Released 16 Feb 2011.
- Method
- X-ray diffraction
- Resolution
- 1.45 Å
- Chains
- 1
- Atoms
- 319
- Mol. weight
- 3.95 kDa
- Released
- 16 Feb 2011
Explore 3M48 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3M48 contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-29 | 26 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| General control protein GCN4 | A | protein | 33 | | P03069 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>3M48_1 General control protein GCN4 (chains A)
RMAQLEAKVEELLSKNWNLENEVARLKKLVGER
Primary citation
GCN4 Leucine Zipper Peptide Mutant. Du, S., Kettering, R.D., Alvarado, J.J. et al. To be published.
Other PDB entries of the same protein (UniProt P03069 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3AZD 0.98 Å, Crystal structure of tropomyosin N-terminal fragment at 0.98A resolution
- 2WQ1 1.08 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating bromide
- 2WQ0 1.12 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride
- 4OWI 1.2 Å, peptide structure
- 2WQ3 1.22 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride and nitrate
- 2HY6 1.25 Å, A seven-helix coiled coil
- 2WPZ 1.25 Å, GCN4 leucine zipper mutant with two VxxNxxx motifs coordinating chloride
- 6PSA 1.3 Å, PIE12 D-peptide against HIV entry (in complex with IQN17 Q577R resistance mutant)
- 2IPZ 1.35 Å, A Parallel Coiled-Coil Tetramer with Offset Helices
- 2YNY 1.35 Å, Salmonella enterica SadA 255-302 fused to GCN4 adaptors (SadAK1)
- 5APU 1.35 Å, Sequence IANKEDKAD inserted between GCN4 adaptors - Structure A9b black
- 2WQ2 1.36 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating iodide
Browse structure collections
About this viewer
MolViewer shows 3M48 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.