3MC0: Staphylococcal Enterotoxin G

Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a Mouse T-cell Receptor beta Chain. Determined by X-ray diffraction at 2.0 Å resolution. Released 13 Oct 2010.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Mus musculus, Staphylococcus aureus
Chains: 4
Atoms: 5,841
Mol. weight: 79.7 kDa
Released: 13 Oct 2010

Explore 3MC0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MC0 contains 21 α-helices and 60 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	31-38	8	2
β-strand	42-49	8	2
β-strand	56-57	2	2
β-strand	65-70	6	1
β-strand	73-78	6	1
α-helix	83-85	3
β-strand	87-95	9	2
β-strand	98-107	4	2
β-strand	111-115	5	2

Chain B: 11 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	6-8	3
α-helix	10-11	2
α-helix	12-17	6
α-helix	23-30	8
α-helix	32-33	2
β-strand	34-39	6	3
β-strand	43	1	4
β-strand	49-52	4	4
β-strand	56	1	5
β-strand	59	1	5
β-strand	62-65	4	4
α-helix	69-75	7
β-strand	80-84	5	3
β-strand	87	1	4
β-strand	107-110	4	4
β-strand	113-115	3	3
α-helix	123	1
β-strand	124-132	9	6
β-strand	136-144	9	6
β-strand	148-150	3	7
α-helix	151-166	16
β-strand	170	1	8
β-strand	173	1	8
β-strand	178-184	7	6
β-strand	190-194	5	6
α-helix	207-210	4
α-helix	211-215	5
β-strand	218-220	3	7
β-strand	225-231	7	6

Chain C: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	9
β-strand	10-13	4	10
β-strand	19-25	7	9
β-strand	31-38	8	10
β-strand	42-49	8	10
β-strand	56-57	2	10
β-strand	65-67	3	9
β-strand	73-78	6	9
α-helix	83-85	3
β-strand	87-95	9	10
β-strand	98-107	4	10
β-strand	111-115	5	10

Chain D: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	12-17	6
α-helix	23-30	8
α-helix	32-33	2
β-strand	34-39	6	11
β-strand	43	1	12
β-strand	49-52	4	12
β-strand	56	1	13
β-strand	59	1	13
β-strand	62-65	4	12
α-helix	69-75	7
β-strand	80-84	5	11
β-strand	87	1	12
β-strand	107-110	4	12
β-strand	113-115	3	11
β-strand	124-132	9	14
β-strand	135-144	10	14
β-strand	148-150	3	15
α-helix	151-166	16
β-strand	170	1	16
β-strand	173	1	16
β-strand	178-184	7	14
β-strand	190-194	5	14
α-helix	207-210	4
α-helix	211-215	5
β-strand	218-220	3	15
β-strand	225-231	7	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
variable beta 8.2 mouse T cell receptor	A, C	protein	109	Mus musculus	A2NTY6 (AlphaFold model)
Enterotoxin SEG	B, D	protein	239	Staphylococcus aureus	D0EMB6 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>3MC0_1 variable beta 8.2  mouse T cell receptor (chains A, C)
AAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIP
DGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Sequence of entity 2 (B, D), FASTA

>3MC0_2 Enterotoxin SEG (chains B, D)
QPDPKLDELNKVSDYKSNKGTMGNVMNLYMSPPVEGRGVINSRQFLSHDLIFPIEYKSYN
EVKTELENTELANNYKGKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSEN
ERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGY
IKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTHHHHHHH

Primary citation

Crystal structure of staphylococcal enterotoxin G (SEG) in complex with a mouse T-cell receptor {beta} chain. Fernandez, M.M., Cho, S., De Marzi, M.C. et al. J Biol Chem (2011) 286:1189-1195. DOI 10.1074/jbc.M110.142471 · PubMed

Other PDB entries of the same protein (UniProt A2NTY6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MJJ 1.93 Å, Crystal structure of the mCD1d/xxm (JJ290) /iNKTCR ternary complex
6MJ4 2.0 Å, Crystal structure of MCD1D/INKTCR TERNARY COMPLEX bound to glycolipid (XXW)
6MIV 2.05 Å, Crystal structure of the mCD1d/xxq (JJ300)/iNKTCR ternary complex
2Z35 2.2 Å, Crystal structure of immune receptor
2PXY 2.23 Å, Crystal structures of immune receptor complexes
6MJI 2.3 Å, Crystal structure of the mCD1d/xxs (JJ304) /iNKTCR ternary complex
2OI9 2.35 Å, Structure of the 2C/Ld/QL9 allogeneic complex
6MJA 2.35 Å, Crystal structure of the mCD1d/xxo (JJ294) /iNKTCR ternary complex
2ICW 2.41 Å, Crystal structure of a complete ternary complex between TCR, superantigen, and…
6MJ6 2.45 Å, Crystal structure of the mCD1d/xxx (JJ166) /iNKTCR ternary complex
2E7L 2.5 Å, Structure of a high-affinity mutant of the 2C TCR in complex with Ld/QL9
3OWE 2.6 Å, Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity…

Browse structure collections

About this viewer

MolViewer shows 3MC0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.