3OWE: Staphylococcal Enterotoxin G

Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain. Determined by X-ray diffraction at 2.6 Å resolution. Released 3 Nov 2010.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Mus musculus, Staphylococcus aureus
Chains: 16
Atoms: 21,680
Mol. weight: 313.51 kDa
Released: 3 Nov 2010

Explore 3OWE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3OWE contains 85 α-helices and 228 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	31-37	7	2
β-strand	43-49	7	2
β-strand	56-57	2	2
β-strand	64-70	7	1
β-strand	73-78	6	1
α-helix	83-85	3
β-strand	87-95	9	2
β-strand	98-101	4	2
β-strand	105-109	5	2

Chain B: 10 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
α-helix	7-9	3
α-helix	13-18	6
α-helix	24-31	8
α-helix	33-34	2
β-strand	35-40	6	3
β-strand	44	1	4
β-strand	50-57	8	4
β-strand	60-66	7	4
α-helix	70-76	7
β-strand	81-85	5	3
β-strand	88	1	4
β-strand	108-110	3	4
β-strand	113-115	3	3
α-helix	122-123	2
β-strand	124-132	9	5
β-strand	135-144	10	5
β-strand	148-150	3	6
α-helix	151-166	16
β-strand	170	1	7
β-strand	173	1	7
β-strand	178-184	7	5
β-strand	190-194	5	5
α-helix	207-210	4
α-helix	211-213	3
β-strand	218-220	3	6
β-strand	225-231	7	5

Chain C: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	8
β-strand	10-13	4	9
β-strand	19-24	6	8
β-strand	31-38	8	9
β-strand	42-49	8	9
β-strand	56-57	2	9
β-strand	64-70	7	8
β-strand	73-78	6	8
α-helix	83-85	3
β-strand	87-94	8	9
β-strand	98-101	4	9
β-strand	105-109	5	9

Chain D: 10 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
α-helix	7-9	3
α-helix	13-18	6
α-helix	24-31	8
α-helix	33-34	2
β-strand	35-40	6	10
β-strand	44	1	11
β-strand	50-57	8	11
β-strand	60-66	7	11
α-helix	67	1
α-helix	70-76	7
β-strand	81-85	5	10
β-strand	88	1	11
β-strand	107-110	4	11
β-strand	113-115	3	10
β-strand	124-132	9	12
β-strand	135-144	10	12
β-strand	148-150	3	13
α-helix	151-166	16
β-strand	170	1	14
β-strand	173	1	14
β-strand	178-184	7	12
β-strand	190-194	5	12
α-helix	207-210	4
α-helix	211-213	3
β-strand	218-220	3	13
β-strand	225-231	7	12

Chain E: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	15
β-strand	10-13	4	9
β-strand	19-25	7	15
β-strand	31-37	7	9
β-strand	43-51	9	9
β-strand	54-57	4	9
β-strand	64-70	7	15
β-strand	73-78	6	15
α-helix	83-85	3
β-strand	87-95	9	9
β-strand	98-101	4	9
β-strand	105-109	5	9

Chain F: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	2-6	5
α-helix	7-9	3
α-helix	11-12	2
α-helix	13-18	6
α-helix	24-31	8
α-helix	33-34	2
β-strand	35-40	6	16
β-strand	44	1	17
β-strand	50-57	8	17
β-strand	60-66	7	17
α-helix	70-76	7
β-strand	81-85	5	16
β-strand	88	1	17
β-strand	94	1	18
β-strand	105	1	18
β-strand	107-110	4	17
β-strand	113-115	3	16
β-strand	124-132	9	19
β-strand	135-144	10	19
β-strand	148-150	3	20
α-helix	151-166	16
β-strand	170	1	21
β-strand	173	1	21
β-strand	178-184	7	19
β-strand	190-194	5	19
α-helix	207-210	4
α-helix	211-215	5
β-strand	218-220	3	20
β-strand	225-231	7	19

Chain G: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	22
β-strand	10-13	4	23
β-strand	19-25	7	22
β-strand	31-37	7	23
β-strand	43-49	7	23
β-strand	56-57	2	23
β-strand	64-70	7	22
β-strand	73-78	6	22
α-helix	83-85	3
β-strand	87-94	8	23
β-strand	98-101	4	23
β-strand	105-109	5	23

Chain H: 9 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
α-helix	7-9	3
α-helix	13-18	6
α-helix	24-31	8
α-helix	33-34	2
β-strand	35-40	6	24
β-strand	44	1	25
β-strand	50-57	8	25
β-strand	60-66	7	25
α-helix	70-76	7
β-strand	81-85	5	24
β-strand	88	1	25
β-strand	108-110	3	25
β-strand	113-115	3	24
β-strand	124-132	9	26
β-strand	135-144	10	26
β-strand	148-150	3	27
α-helix	151-165	15
β-strand	170	1	28
β-strand	173	1	28
β-strand	178-184	7	26
β-strand	190-194	5	26
α-helix	207-210	4
α-helix	211-215	5
β-strand	218-220	3	27
β-strand	225-231	7	26

8 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-chain	A, C, E, G, I, K, M, O	protein	112	Mus musculus	A2NTY6 (AlphaFold model)
Enterotoxin SEG	B, D, F, H, J, L, N, P	protein	234	Staphylococcus aureus	Q9ZNF2 (AlphaFold model)

Sequence of entity 1 (A, C, E, G, I, K, M, O), FASTA

>3OWE_1 Beta-chain (chains A, C, E, G, I, K, M, O)
AAEAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGVGNTEKG
DIPDGYEASRPSHEQFSLILVSATPSQSSVYFCASGVGGTLYFGAGTRLSVL

Sequence of entity 2 (B, D, F, H, J, L, N, P), FASTA

>3OWE_2 Enterotoxin SEG (chains B, D, F, H, J, L, N, P)
AQPDPKLDELNKVSDYKSNKGTMGNVMNLYMSPPVEGRGVINSRQFLSHDLIFPIEYKSY
NEVKTELENTELANNYKGKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSE
NERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESG
YIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH

Primary citation

Crystal structure of staphylococcal enterotoxin G (SEG) in complex with a mouse T-cell receptor {beta} chain. Fernandez, M.M., Cho, S., De Marzi, M.C. et al. J Biol Chem (2011) 286:1189-1195. DOI 10.1074/jbc.M110.142471 · PubMed

Other PDB entries of the same protein (UniProt A2NTY6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MJJ 1.93 Å, Crystal structure of the mCD1d/xxm (JJ290) /iNKTCR ternary complex
3MC0 2.0 Å, Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a Mouse T-cell…
6MJ4 2.0 Å, Crystal structure of MCD1D/INKTCR TERNARY COMPLEX bound to glycolipid (XXW)
6MIV 2.05 Å, Crystal structure of the mCD1d/xxq (JJ300)/iNKTCR ternary complex
2Z35 2.2 Å, Crystal structure of immune receptor
2PXY 2.23 Å, Crystal structures of immune receptor complexes
6MJI 2.3 Å, Crystal structure of the mCD1d/xxs (JJ304) /iNKTCR ternary complex
2OI9 2.35 Å, Structure of the 2C/Ld/QL9 allogeneic complex
6MJA 2.35 Å, Crystal structure of the mCD1d/xxo (JJ294) /iNKTCR ternary complex
2ICW 2.41 Å, Crystal structure of a complete ternary complex between TCR, superantigen, and…
6MJ6 2.45 Å, Crystal structure of the mCD1d/xxx (JJ166) /iNKTCR ternary complex
2E7L 2.5 Å, Structure of a high-affinity mutant of the 2C TCR in complex with Ld/QL9

Browse structure collections

About this viewer

MolViewer shows 3OWE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.