3MCE: PDB entry 3MCE

Crystal structure of the NAC domain of alpha subunit of nascent polypeptide-associated complex(NAC). Determined by X-ray diffraction at 2.4 Å resolution. Released 14 Jul 2010.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,884
Mol. weight: 27.84 kDa
Released: 14 Jul 2010

Explore 3MCE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MCE contains 11 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
α-helix	80-82	3
β-strand	86-87	2	1
β-strand	91-98	8	2
β-strand	102-106	5	2
β-strand	110-113	4	1
β-strand	119-123	5	1
β-strand	126-129	4	2

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	75-77	3
α-helix	78-83	6
β-strand	86-88	3	1
α-helix	89	1
β-strand	91-98	8	2
β-strand	102-107	6	2
β-strand	110-113	4	1
β-strand	119-123	5	1
α-helix	126	1
β-strand	127-130	4	2

Chain C: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	75-77	3
α-helix	78-83	6
β-strand	86-87	2	3
α-helix	88	1
β-strand	91-98	8	3
β-strand	102-107	6	3
β-strand	110-113	4	3
β-strand	119-123	5	3
α-helix	125	1
β-strand	126-129	4	3

Chain D: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	78-81	4
β-strand	86-87	2	3
α-helix	88	1
β-strand	91-98	8	3
β-strand	102-113	12	3
β-strand	119-130	12	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nascent polypeptide-associated complex subunit alpha	A, B, C, D	protein	61	Homo sapiens	Q13765 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3MCE_1 Nascent polypeptide-associated complex subunit alpha (chains A, B, C, D)
GPLGSPEFSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLS
Q

Primary citation

Crystal structures of NAC domains of human nascent polypeptide-associated complex (NAC) and its alphaNAC subunit. Wang, L.F., Zhang, W.C., Wang, L. et al. Protein Cell (2010) 1:406-416. DOI 10.1007/s13238-010-0049-3 · PubMed

Other PDB entries of the same protein (UniProt Q13765 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3MCB 1.9 Å, Crystal structure of NAC domains of human nascent polypeptide-associated complex (NAC)
9I2D 2.19 Å, NMT1-NAC bound human RNC with 10 amino acid ARF1-linker
9S3D 2.32 Å, NAC bound human RNC with 58 amino acid ARF1-linker
9S3B 2.38 Å, NMT1-NAC bound human RNC with 58 amino acid ARF1-linker - State 1
9S3C 2.42 Å, NMT1-NAC bound human RNC with 58 amino acid ARF1-linker - State 2
9QLO 2.47 Å, NMT1-NAC bound human RNC with full length ARF1 - State 1
3LKX 2.5 Å, Human nac dimerization domain
9QLQ 2.57 Å, NMT1-NAC bound human RNC with full length ARF1 - alternative State
9MR4 2.65 Å, NAC: Ribosome nascent chain complex(Oxa1L)
9T6D 2.67 Å, NAA40-NAC bound human 80S (combined translation states)
28LN 2.7 Å, XBP1u-stalled RPL4 RNC in complex with NAC
9RG7 2.72 Å, In vitro reconstituted NAA40-NAC bound 80S

Browse structure collections

About this viewer

MolViewer shows 3MCE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.