3MCL: C706 monoclonal light chain

Anti-beta-amyloid antibody c706 fab in space group P21. Determined by X-ray diffraction at 1.7 Å resolution. Released 24 Nov 2010.

Method: X-ray diffraction
Resolution: 1.7 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 3,793
Mol. weight: 47.28 kDa
Released: 24 Nov 2010

Explore 3MCL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MCL contains 18 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 11 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	7
β-strand	10-12	3	8
β-strand	18-25	8	7
α-helix	29-31	3
α-helix	33	1
β-strand	34-39	6	8
β-strand	45-52	8	8
β-strand	57-60	4	8
α-helix	62-64	3
β-strand	68-73	6	7
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-99	8	8
β-strand	106-109	4	8
β-strand	113-117	5	8
α-helix	121-122	2
β-strand	123	1	9
α-helix	124-125	2
β-strand	126-134	9	10
β-strand	141-151	11	10
β-strand	152	1	9
β-strand	157-160	4	11
α-helix	161-163	3
β-strand	165	1	11
β-strand	169-171	3	10
α-helix	172-174	3
β-strand	175-176	2	10
β-strand	182-191	10	10
α-helix	192-194	3
β-strand	201-206	6	11
α-helix	207-209	3
β-strand	211-216	6	11
α-helix	218-220	3

Chain L: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
β-strand	4-7	4	2
β-strand	10-13	4	3
β-strand	19-29	11	2
β-strand	33-37	5	3
β-strand	44-48	5	3
β-strand	52-53	2	3
α-helix	54	1
β-strand	61-74	14	2
α-helix	79-81	3
β-strand	83-88	6	3
β-strand	92	1	1
β-strand	96	1	3
β-strand	100-104	5	3
β-strand	109	1	4
α-helix	110-111	2
β-strand	112-116	5	5
α-helix	117-119	3
α-helix	120-124	5
β-strand	127-137	11	5
β-strand	138	1	4
β-strand	143-148	6	6
β-strand	151-152	2	6
β-strand	157-161	5	5
α-helix	162-165	4
β-strand	171-180	10	5
α-helix	181-184	4
β-strand	189-195	7	6
β-strand	203-208	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C706 monoclonal light chain	L	protein	212	Mus musculus, Homo sapiens
C706 monoclonal heavy chain	H	protein	228	Mus musculus, Homo sapiens	P01857 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>3MCL_1 C706 MONOCLONAL LIGHT CHAIN (chains L)
QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSGTSPKRWIYDSSRLASGVPSR
FSGGGSGTSYSLTISNMEAEDAATYFCQNWRSSPTFGAGTKLELKRTVAAPSVFIFPPSD
EQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS
KADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 2 (H), FASTA

>3MCL_2 C706 MONOCLONAL HEAVY CHAIN (chains H)
QVQLQQSGPELMKPGASVKISCKATGYTFSTSWIEWIKQRPGHGLEWIGEVLPGSGKSNH
NANFKGRATFTADTASNTAYMQLSSLTSEDSAVYYCAREGSNNNALAYWGQGTLVTVSAA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCHHHHHH

Primary citation

His-tag binding by antibody C706 mimics Beta-amyloid recognition. Teplyakov, A., Obmolova, G., Canziani, G. et al. J Mol Recognit (2010) 24:570-575. DOI 10.1002/jmr.1069 · PubMed

Other PDB entries of the same protein (UniProt P01857 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LLD 1.19 Å, Structure of wild-type IgG1 antibody heavy chain constant domain 1 and light chain…
3TV3 1.29 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT128 in complex with…
4LLQ 1.42 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
5HSF 1.52 Å, 1.52 Angstrom Crystal Structure of Fc fragment of Human IgG1.
6YT7 1.55 Å, Glycosylated knob/dummy-hole fc fragment
4NWU 1.6 Å, Crystal structure of APE1551, an anti-human NGF Fab with a nine amino acid insertion in…
1L6X 1.65 Å, Fc fragment of rituximab bound to a minimized version of the B-domain from protein A…
3TWC 1.65 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT127 in complex with…
5JIH 1.66 Å, Crystal structure of HER2 binding IgG1-Fc (Fcab STAB19)
5U66 1.7 Å, Modified single helix from the B-domain of protein A bound to IgG1 Fc
6N35 1.75 Å, Anti-HIV-1 Fab 2G12 + Man1-2 re-refinement
3DJ9 1.75 Å, Crystal Structure of an isolated, unglycosylated antibody CH2 domain

Browse structure collections

About this viewer

MolViewer shows 3MCL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.