Crystal structure of Staphylococcal nuclease variant Delta+PHS L38A at cryogenic temperature. Determined by X-ray diffraction at 1.55 Å resolution. Released 23 Mar 2011.
Explore 3MHB in 3D Show helices and sheets RCSB PDB PDBe
3MHB contains 5 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-17 | 9 | 1 |
| β-strand | 22-27 | 6 | 1 |
| β-strand | 30-36 | 7 | 1 |
| β-strand | 39-40 | 2 | 2 |
| α-helix | 41-43 | 3 | |
| α-helix | 55-68 | 14 | |
| β-strand | 72-75 | 4 | 1 |
| β-strand | 82 | 1 | 1 |
| β-strand | 88-94 | 7 | 1 |
| β-strand | 97-98 | 2 | 1 |
| α-helix | 99-105 | 7 | |
| β-strand | 110-111 | 2 | 2 |
| α-helix | 122-134 | 13 | |
| α-helix | 138-140 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thermonuclease | A | protein | 143 | Staphylococcus aureus | P00644 (AlphaFold model) |
>3MHB_1 Thermonuclease (chains A) ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLAVDTPEFNEKYGPEASAFTKKMV ENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR KAEAQAKKEKLNIWSEDNADSGQ
Cavities determine the pressure unfolding of proteins. Roche, J., Caro, J.A., Norberto, D.R. et al. Proc Natl Acad Sci U S A (2012) 109:6945-6950. DOI 10.1073/pnas.1200915109 · PubMed
Other PDB entries of the same protein (UniProt P00644 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3MHB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.