4OWR: MRNA export factor

Vesiculoviral matrix (M) protein occupies nucleic acid binding site at nucleoporin pair Rae1-Nup98. Determined by X-ray diffraction at 3.15 Å resolution. Released 25 Jun 2014.

Method: X-ray diffraction
Resolution: 3.15 Å
Organisms: Homo sapiens, Vesicular stomatitis Indiana virus
Chains: 3
Atoms: 4,471
Mol. weight: 66.1 kDa
Released: 25 Jun 2014

Explore 4OWR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OWR contains 17 α-helices and 45 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 35 β-strands

Element	Residues	Length	Sheet
β-strand	32	1	1
β-strand	42-47	6	2
α-helix	48-49	2
β-strand	55-61	7	2
β-strand	65-71	7	2
β-strand	77-84	8	2
β-strand	89-94	6	3
β-strand	100-105	6	3
β-strand	109-114	6	3
β-strand	119-125	7	3
β-strand	130-138	9	4
β-strand	141-148	8	4
β-strand	152-156	5	4
β-strand	165-168	4	4
β-strand	173-179	7	5
β-strand	182-187	6	5
α-helix	188-190	3
β-strand	191-196	6	5
β-strand	202-206	5	5
β-strand	215-219	5	6
β-strand	222	1	7
β-strand	228	1	7
β-strand	230-235	6	6
β-strand	239-244	6	6
α-helix	250-253	4
β-strand	255-258	4	6
β-strand	261-262	2	8
α-helix	269	1
β-strand	270-273	4	8
β-strand	276-281	6	9
β-strand	288-292	5	9
β-strand	297-301	5	9
β-strand	306-310	5	9
α-helix	312-314	3
β-strand	318-323	6	10
β-strand	329	1	11
β-strand	330-334	5	10
α-helix	342-344	3
α-helix	350-351	2
β-strand	352-354	3	10
β-strand	355	1	1
β-strand	357	1	11

Chain B: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	163-164	2
β-strand	168-173	6	8
β-strand	180-186	7	8
α-helix	189-191	3
α-helix	200-209	10

Chain C: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	60-74	15	12
α-helix	81-88	8
α-helix	89-92	4
α-helix	99-101	3
α-helix	102-115	14
β-strand	117-119	3	12
β-strand	130-143	14	12
α-helix	148-150	3
β-strand	156-164	9	12
β-strand	167-179	13	12
β-strand	188	1	12
α-helix	189-191	3
α-helix	200-206	7
β-strand	210-213	4	12
β-strand	221-225	5	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
mRNA export factor	A	protein	339	Homo sapiens	P78406 (AlphaFold model)
Nuclear pore complex protein Nup98-Nup96	B	protein	59	Homo sapiens	P52948 (AlphaFold model)
Matrix protein	C	protein	188	Vesicular stomatitis Indiana virus	Q8B0H7

Sequence of entity 1 (A), FASTA

>4OWR_1 mRNA export factor (chains A)
MDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPV
LDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSW
DKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIES
PLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSA
PQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNI
FAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK

Sequence of entity 2 (B), FASTA

>4OWR_2 Nuclear pore complex protein Nup98-Nup96 (chains B)
GSPTGTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANRK

Sequence of entity 3 (C), FASTA

>4OWR_3 Matrix protein (chains C)
GSSYFGVDEMDTHDPNQLRYEKFFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGK
RPFYKILAFLGSSNLKATPGGSGDQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRP
FNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEKKASGAWV
LDSVSHFK

Primary citation

Vesiculoviral matrix (M) protein occupies nucleic acid binding site at nucleoporin pair (Rae1 Nup98). Quan, B., Seo, H.S., Blobel, G. et al. Proc Natl Acad Sci U S A (2014) 111:9127-9132. DOI 10.1073/pnas.1409076111 · PubMed

Other PDB entries of the same protein (UniProt P78406 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3MMY 1.65 Å, Structural and functional analysis of the interaction between the nucleoporin Nup98 and…
7F90 2.39 Å, Crystal structure of SARS auxiliary protein in complex with human nuclear protein
7VPG 2.49 Å, Crystal structure of the C-terminal tail of SARS-CoV-1 Orf6 complex with human…
7VPH 2.8 Å, Crystal structure of the C-terminal tail of SARS-CoV-2 Orf6 complex with human…
7F60 2.85 Å, Crystal structure of auxiliary protein in complex with human nuclear protein

Browse structure collections

About this viewer

MolViewer shows 4OWR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.