3MQR: USP7:HdmX(AHSS) complex

Crystal Structure of the USP7:HdmX(AHSS) complex. Determined by X-ray diffraction at 1.8 Å resolution. Released 25 Aug 2010.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,268
Mol. weight: 19.22 kDa
Released: 25 Aug 2010

Explore 3MQR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MQR contains 5 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	68-75	8	1
α-helix	78-80	3
β-strand	85-86	2	2
α-helix	87-89	3
β-strand	90-92	3	2
β-strand	95-104	10	2
β-strand	113-121	9	2
β-strand	131-140	10	1
α-helix	146-148	3
β-strand	150-159	10	1
β-strand	162	1	1
β-strand	164-172	9	2
α-helix	173-176	4
β-strand	185	1	3
β-strand	188	1	3
β-strand	189-197	9	1
α-helix	198-200	3
β-strand	201	1	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	399	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin carboxyl-terminal hydrolase 7	A	protein	155	Homo sapiens	Q93009 (AlphaFold model)
HdmX Peptide	B	protein	10	Homo sapiens	O15151 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3MQR_1 Ubiquitin carboxyl-terminal hydrolase 7 (chains A)
GSHTAEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRP
HQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNF
MAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAW

Sequence of entity 2 (B), FASTA

>3MQR_2 HdmX Peptide (chains B)
LDLAHSSESQ

Primary citation

Crystal Structure Of USP7. Sarkari, F., La Delfa, A., Arrowsmith, C.H. et al. To be published.

Other PDB entries of the same protein (UniProt Q93009 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4YSI 1.02 Å, Structure of USP7 with a novel viral protein
5KYC 1.43 Å, Crystal structure of USP7 catalytic domain [V302K] mutant in complex with ubiquitin…
5KYF 1.45 Å, Crystal structure of USP7 catalytic domain [L299A] mutant in complex with ubiquitin
2FOJ 1.6 Å, The Crystal Structure of the N-terminal domain of HAUSP/USP7 complexed with p53 peptide…
2XXN 1.6 Å, Structure of the vIRF4-HAUSP TRAF domain complex
5KYD 1.62 Å, Crystal structure of USP7 catalytic domain [V302K] mutant in complex with ubiquitin
12ZJ 1.63 Å, Crystal structure of USP7 TRAF domain in complex with MAGEL2 peptide (968-980)
2F1W 1.65 Å, Crystal structure of the TRAF-like domain of HAUSP/USP7
1YY6 1.7 Å, The Crystal Structure of the N-terminal domain of HAUSP/USP7 complexed with an EBNA1…
2F1Y 1.7 Å, Crystal structure of the TRAF-like domain of HAUSP/USP7 bound to a MDM2 peptide
4KG9 1.7 Å, Crystal Structure Of USP7-NTD with MCM-BP
5N9T 1.73 Å, Crystal structure of USP7 in complex with a potent, selective and reversible…

Browse structure collections

About this viewer

MolViewer shows 3MQR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.