3MSH: Hepatitis B virus X-interacting protein

Crystal structure of Hepatitis B X-Interacting Protein at high resolution. Determined by X-ray diffraction at 1.51 Å resolution. Released 10 Nov 2010.

Method: X-ray diffraction
Resolution: 1.51 Å
Organism: Homo sapiens
Chains: 1
Atoms: 802
Mol. weight: 11.26 kDa
Ligands: PO4, IPA
Released: 10 Nov 2010

Explore 3MSH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MSH contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	5-13	9
β-strand	18-24	7	1
β-strand	30-35	6	1
α-helix	39-41	3
α-helix	42-54	13
β-strand	65-69	5	1
β-strand	72-79	8	1
β-strand	82-88	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hepatitis B virus X-interacting protein	A	protein	99	Homo sapiens	O43504 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3MSH_1 Hepatitis B virus X-interacting protein (chains A)
MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPT
DIPVVCLESDNGNIMIQKHDGITVAVHKMASLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1
IPA	Isopropyl alcohol	C3 H8 O	3

Water and common crystallization additives (PG4, GOL) are not listed.

Primary citation

Structural Characterization of HBXIP: The Protein That Interacts with the Anti-Apoptotic Protein Survivin and the Oncogenic Viral Protein HBx. Garcia-Saez, I., Lacroix, F.B., Blot, D. et al. J Mol Biol (2011) 405:331-340. DOI 10.1016/j.jmb.2010.10.046 · PubMed

Other PDB entries of the same protein (UniProt O43504 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6B9X 1.42 Å, Crystal structure of Ragulator
5X6V 2.02 Å, Crystal structure of human heteroheptameric complex
5YK5 2.03 Å, structure of the human Lamtor4-Lamtor5 complex
3MS6 2.08 Å, Crystal structure of Hepatitis B X-Interacting Protein (HBXIP)
6EHP 2.3 Å, The crystal structure of the human LAMTOR complex
5X6U 2.4 Å, Crystal structure of human heteropentameric complex
5Y39 2.65 Å, Crystal structure of Ragulator complex (p18 76-145)
5Y38 2.8 Å, Crystal structure of C7orf59-HBXIP complex
5VOK 2.89 Å, Crystal structure of the C7orf59-HBXIP dimer
6EHR 2.9 Å, The crystal structure of the human LAMTOR-RagA CTD-RagC CTD complex
5Y3A 2.9 Å, Crystal structure of Ragulator complex (p18 49-161)
7UX2 2.9 Å, cryo-EM structure of the Raptor-TFEB-Rag-Ragulator complex

Browse structure collections

About this viewer

MolViewer shows 3MSH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.