Crystal Structure of HP67 H41F - P212121. Determined by X-ray diffraction at 1.7 Å resolution. Released 25 May 2011.
Explore 3MYC in 3D Show helices and sheets RCSB PDB PDBe
3MYC contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 18-22 | 5 | |
| α-helix | 26-28 | 3 | |
| α-helix | 38-41 | 4 | |
| α-helix | 44-51 | 8 | |
| α-helix | 55-60 | 6 | |
| α-helix | 63-73 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Villin-1 | A | protein | 67 | Gallus gallus | P02640 (AlphaFold model) |
>3MYC_1 Villin-1 (chains A) PTKLETFPLDVLVNTAAEDLPRGVDPSRKENFLSDEDFKAVFGMTRSAFANLPLWKQQNL KKEKGLF
On unsatisfied hydrogen bonds in the N-terminal subdomain of villin headpiece. Brown, J.W., Farelli, J.D., McKnight, C.J. J Mol Biol (2011) 413:543-547. DOI 10.1016/j.jmb.2011.08.024 · PubMed
Other PDB entries of the same protein (UniProt P02640 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3MYC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.