3N1G: DhhN

Crystal structure of DhhN bound to BOCFn3. Determined by X-ray diffraction at 1.9 Å resolution. Released 2 Jun 2010.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,816
Mol. weight: 64.05 kDa
Ligands: CA, ZN, MG
Released: 2 Jun 2010

Explore 3N1G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3N1G contains 24 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	41-44	4
β-strand	48-49	2	5
α-helix	66-68	3
α-helix	72-75	4
β-strand	78-79	2	6
β-strand	85-87	3	5
α-helix	95-97	3
β-strand	98-99	2	6
α-helix	101-117	17
β-strand	123-127	5	5
α-helix	136	1
α-helix	140-143	4
β-strand	146-151	6	5
α-helix	156-158	3
α-helix	159-168	10
β-strand	173-175	3	5
β-strand	182-185	4	5

Chain B: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	42-44	3
β-strand	48-49	2	1
α-helix	66-68	3
α-helix	72-75	4
β-strand	78-79	2	2
β-strand	85-87	3	1
α-helix	95-97	3
β-strand	98-99	2	2
α-helix	101-117	17
β-strand	123-127	5	1
α-helix	136	1
α-helix	140-143	4
β-strand	146-151	6	1
α-helix	156-158	3
α-helix	159-168	10
β-strand	173-175	3	1
β-strand	182-185	4	1

Chain C: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	717-725	9	3
β-strand	728-734	7	3
α-helix	737-740	4
β-strand	747-754	8	4
α-helix	760-762	3
β-strand	764-769	6	4
β-strand	774-777	4	3
β-strand	785-793	9	4
β-strand	798	1	4
α-helix	799-801	3
β-strand	805-808	4	4
α-helix	809-811	3

Chain D: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	717-723	7	7
β-strand	729-734	6	7
β-strand	747-754	8	8
α-helix	760-762	3
β-strand	764-769	6	8
β-strand	774-777	4	7
β-strand	785-793	9	8
β-strand	798	1	8
β-strand	805-808	4	8
α-helix	809-812	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Desert hedgehog protein	A, B	protein	170	Homo sapiens	O43323 (AlphaFold model)
Brother of CDO	C, D	protein	111	Homo sapiens	Q9BWV1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3N1G_1 Desert hedgehog protein (chains A, B)
GSGPGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVP
NYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDS
LHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKAD

Sequence of entity 2 (C, D), FASTA

>3N1G_2 Brother of CDO (chains C, D)
GSTERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKD
MVEGDKYWHSISHLQPETSYDIKMQCFNEGGESEFSNVMICETKARKSSGQ

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4
ZN	Zinc ion	Zn	2
MG	Magnesium ion	Mg	1

Primary citation

All mammalian Hedgehog proteins interact with cell adhesion molecule, down-regulated by oncogenes (CDO) and brother of CDO (BOC) in a conserved manner. Kavran, J.M., Ward, M.D., Oladosu, O.O. et al. J Biol Chem (2010) 285:24584-24590. DOI 10.1074/jbc.M110.131680 · PubMed

Other PDB entries of the same protein (UniProt O43323 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WFQ 1.85 Å, Crystal structure of the N-terminal signalling domain of human Dhh without calcium
2WFR 1.95 Å, Crystal structure of the N-terminal signalling domain of human Dhh with calcium
2WG3 2.6 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…
3N1Q 2.89 Å, Crystal Structure of DhhN bound to CDOFn3

Browse structure collections

About this viewer

MolViewer shows 3N1G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.