3NAF: PDB entry 3NAF

Structure of the Intracellular Gating Ring from the Human High-conductance Ca2+ gated K+ Channel (BK Channel). Determined by X-ray diffraction at 3.1 Å resolution. Released 30 Jun 2010.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 5,076
Mol. weight: 89.37 kDa
Released: 30 Jun 2010

Explore 3NAF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3NAF contains 35 α-helices and 31 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 35 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	343-348	6	1
α-helix	353-363	11
β-strand	373-379	7	1
α-helix	382-384	3
α-helix	385-393	9
β-strand	398-402	5	1
α-helix	408-413	6
α-helix	416-418	3
β-strand	421-424	4	1
α-helix	433-450	18
β-strand	456-460	5	1
α-helix	465-467	3
α-helix	469-471	3
β-strand	482-485	4	1
α-helix	486-499	14
α-helix	503-511	9
α-helix	524-532	9
β-strand	534	1	2
β-strand	537-540	4	3
α-helix	541-542	2
α-helix	543-545	3
β-strand	549	1	4
α-helix	550-560	11
β-strand	565-571	7	3
β-strand	577-581	5	3
α-helix	587	1
β-strand	588	1	4
α-helix	589	1
β-strand	594-597	4	3
β-strand	600	1	2
α-helix	604-609	6
α-helix	620-625	6
β-strand	686	1	5
β-strand	693	1	5
α-helix	696-699	4
α-helix	700-702	3
β-strand	704	1	6
α-helix	707-712	6
β-strand	719-724	6	7
α-helix	735-742	8
β-strand	754-757	4	7
β-strand	758	1	8
α-helix	760-767	8
β-strand	776-777	2	7
β-strand	778	1	6
β-strand	780	1	8
α-helix	786-791	6
β-strand	799-804	6	7
α-helix	818-829	12
β-strand	878-882	5	7
α-helix	887-891	5
α-helix	903-905	3
α-helix	907-911	5
β-strand	914-916	3	7
α-helix	919-929	11
α-helix	932-941	10
α-helix	946-952	7
α-helix	968-970	3
β-strand	976-981	6	9
α-helix	996-1000	5
α-helix	1002-1005	4
β-strand	1010-1011	2	9
β-strand	1013-1017	5	10
β-strand	1031-1035	5	10
β-strand	1048-1053	6	9
α-helix	1054-1055	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium-activated potassium channel subunit alpha-1,Calcium-activated potassium channel subunit…	A	protein	798	Homo sapiens	Q12791 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3NAF_1 Calcium-activated potassium channel subunit alpha-1,Calcium-activated potassium channel subunit alpha-1,Calcium-activated potassium channel subunit alpha-1 (chains A)
GAMPDEFRMKQIEDKLEEILSKLYHIENELARIKKLLGERKKYGGSYSAVSGRKHIVVCG
HITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPH
DLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHL
LNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYL
EGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKI
QEGTLGFFIASDAKEVKRAFFYCKACHXXXXXXXXXXXXXXXXSPKLMRHDPLLIPGNDQ
IDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLR
NLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNIN
LCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSS
PDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAF
AVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRC
RVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVIT
NPPYEFELVPTDLIFCLMQFDHNAGQSRASLSHSSHSSQSSSKKSSSVHSIPSTANRQNR
PKSRESRDKQKYVQEERL

Primary citation

Structure of the gating ring from the human large-conductance Ca(2+)-gated K(+) channel. Wu, Y., Yang, Y., Ye, S. et al. Nature (2010) 466:393-397. DOI 10.1038/nature09252 · PubMed

Other PDB entries of the same protein (UniProt Q12791 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6V5A 2.0 Å, Crystal structure of the human BK channel gating ring L390P mutant
8V60 2.43 Å, F315A mutant of human Slo1 in presence of EDTA - resting VSD
11DA 2.57 Å, Human Slo1-PenitremA complex under divalent chelated condition - full model
9CZM 2.57 Å, Ca2+ bound open-inactivated hSlo1 + beta2N-beta4 channel in nanodisc.
11DC 2.58 Å, Human Slo1-PenitremA complex under divalent chelated condition - gating-ring masked out
11CZ 2.6 Å, Human Slo1-paxilline complex under divalent chelated condition - full model
8V64 2.6 Å, RCK1-RCK2 double mutant of human Slo1 in presence of EDTA - resting VSD
8GHF 2.7 Å, cryo-EM structure of hSlo1 in plasma membrane vesicles
11DB 2.71 Å, Human Slo1-Paxilline complex under divalent chelated condition - gating-ring masked
8V63 2.72 Å, R207A mutant of human Slo1 in presence of EDTA - activated VSD
9JO3 2.8 Å, Cryo-EM structure of human BKca channel-compound 10b complex
8VAZ 2.82 Å, Structure of human Slo1 and human LRRC26 in EDTA - LRRD masked

Browse structure collections

About this viewer

MolViewer shows 3NAF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.