3NCU: Rig-I

Structural and functional insights into pattern recognition by the innate immune receptor RIG-I. Determined by X-ray diffraction at 2.55 Å resolution. Released 30 Jun 2010.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,604
Mol. weight: 39.26 kDa
Ligands: ZN
Released: 30 Jun 2010

Explore 3NCU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3NCU contains 14 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	806-810	5	1
β-strand	816-819	4	1
α-helix	820-822	3
β-strand	823-826	4	2
β-strand	830-833	4	2
α-helix	836-839	4
β-strand	842-853	12	3
β-strand	856-864	9	3
β-strand	872-879	8	3
β-strand	882-887	6	3
α-helix	889-891	3
β-strand	892-896	5	1
β-strand	902-903	2	1
α-helix	908-910	3
α-helix	916	1
β-strand	917	1	2
α-helix	918	1
α-helix	920-922	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rig-I	A, B	protein	134	Homo sapiens	O95786 (AlphaFold model)
5'-r((gdp)papcpgpcpupapgpcpgpupc)-3'	C, D	RNA	12

Sequence of entity 1 (A, B), FASTA

>3NCU_1 RIG-I (chains A, B)
DSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPK
QFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDF
HFEKIPFDPAEMSK

Sequence of entity 2 (C, D), FASTA

>3NCU_2 5'-R(*(GDP)P*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C)-3' (chains C, D)
GACGCUAGCGUC

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structural and functional insights into 5'-ppp RNA pattern recognition by the innate immune receptor RIG-I. Wang, Y., Ludwig, J., Schuberth, C. et al. Nat Struct Mol Biol (2010) 17:781-787. DOI 10.1038/nsmb.1863 · PubMed

Other PDB entries of the same protein (UniProt O95786 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BAH 1.89 Å, Structure of RIG-I CTD bound to OH-RNA
7MK1 1.9 Å, Structure of a protein-modified aptamer complex
3LRR 2.15 Å, Crystal structure of human RIG-I CTD bound to a 12 bp AU rich 5' ppp dsRNA
3OG8 2.4 Å, Crystal structure of human RIG-I CTD bound to a 14-bp blunt-ended dsRNA
9KU4 2.4 Å, Cryo-EM structure of E373A mutant RIG-I with 5'p-RNA
2YKG 2.5 Å, Structural insights into RNA recognition by RIG-I
3ZD7 2.5 Å, Snapshot 3 of RIG-I scanning on RNA duplex
4BPB 2.58 Å, Structural insights into RNA recognition by rig-I
3LRN 2.6 Å, Crystal structure of human RIG-I CTD bound to a 14 bp GC 5' ppp dsRNA
9KTW 2.6 Å, Cryo-EM structure of wild type RIG-I with 5'p-RNA
5F9F 2.6 Å, Crystal structure of RIG-I helicase-RD in complex with 24-mer blunt-end hairpin RNA
2QFD 2.7 Å, Crystal structure of the regulatory domain of human RIG-I with bound Hg

Browse structure collections

About this viewer

MolViewer shows 3NCU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.