3NED: MRouge

Name: PDB 3NED: mRouge
Published: 2010-11-24
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

mRouge. Determined by X-ray diffraction at 0.95 Å resolution. Released 24 Nov 2010.

Method: X-ray diffraction
Resolution: 0.95 Å
Organism: Discosoma sp.
Chains: 1
Atoms: 2,617
Mol. weight: 27.88 kDa
Released: 24 Nov 2010

Explore 3NED in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3NED contains 9 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	2-7	6
β-strand	12-22	11	1
β-strand	25-36	12	1
β-strand	41-50	10	1
α-helix	52	1
α-helix	54	1
α-helix	58-60	3
α-helix	62-64	3
β-strand	74	1	1
α-helix	82-85	4
β-strand	91-99	9	1
β-strand	104-114	11	1
β-strand	117-127	11	1
β-strand	140-143	4	1
α-helix	144-145	2
β-strand	146-153	8	1
β-strand	156-167	12	1
β-strand	172-183	12	1
α-helix	187-190	4
β-strand	193-204	12	1
β-strand	210-221	12	1
α-helix	225-227	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PAmCherry1 protein	A	protein	242	Discosoma sp.	D1MPT3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3NED_1 PAmCherry1 protein (chains A)
MGHHHHHHGVSKGEEDNMAIIKEFMRFKTHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLK
VTKGGPLPFAWDILSPQFXSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQ
DSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEACSERMYPEDGALKGEMKMRLKLKD
GGHYDAEVKTTYKAKKPVQLPGAYNTNTKLDITSHNEDYTIVEQYERNEGRHSTGGMDEL
YK

Primary citation

Generation of longer emission wavelength red fluorescent proteins using computationally designed libraries. Chica, R.A., Moore, M.M., Allen, B.D. et al. Proc Natl Acad Sci U S A (2010) 107:20257-20262. DOI 10.1073/pnas.1013910107 · PubMed

Other PDB entries of the same protein (UniProt D1MPT3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MZ3 1.09 Å, mCherry pH sensitive mutant - M66T (mCherryTYG)
3LF3 1.15 Å, Crystal Structure of Fast Fluorescent Timer Fast-FT
7SAK 1.15 Å, Crystal Structure of LaM4 Nanobody bound to mCherry
31AL 1.5 Å, Synchrotron structure of non-photoactivated PAmCherry1
3KCS 1.5 Å, Crystal structure of PAmCherry1 in the dark state
9FEL 1.5 Å, LSSmCherry1 - Directionality of Optical Properties of Fluorescent Proteins
6YLM 1.6 Å, mCherry
31JT 1.63 Å, SFX structure of non-photoactivated PAmCherry1
3KCT 1.65 Å, CRYSTAL STRUCTURE OF PAmCherry1 in the photoactivated state
3NEZ 1.7 Å, mRojoA
5H89 1.76 Å, Crystal structure of mRojoA mutant - T16V - P63Y - W143G - L163V
3LF4 1.81 Å, Crystal Structure of Fluorescent Timer Precursor Blue102

Browse structure collections

About this viewer

MolViewer shows 3NED directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.