3NEQ: Three-finger muscarinic toxin 7

Name: PDB 3NEQ: Crystal structure of the chimeric muscarinic toxin MT7 with loop 3 from MT1
Published: 2011-08-24
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Crystal structure of the chimeric muscarinic toxin MT7 with loop 3 from MT1. Determined by X-ray diffraction at 1.25 Å resolution. Released 24 Aug 2011.

Method: X-ray diffraction
Resolution: 1.25 Å
Organism: Dendroaspis angusticeps
Chains: 2
Atoms: 1,580
Mol. weight: 15.58 kDa
Released: 24 Aug 2011

Explore 3NEQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3NEQ contains 4 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	6	1	2
α-helix	11-12	2
β-strand	13-16	4	1
α-helix	17-18	2
β-strand	23-32	10	2
β-strand	35-43	9	2
β-strand	54-59	6	2

Chain B: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	3
β-strand	6	1	4
β-strand	7	1	3
β-strand	10-16	7	3
α-helix	17-18	2
β-strand	23-32	10	4
β-strand	35-43	9	4
α-helix	46-49	4
β-strand	54-59	6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Three-finger muscarinic toxin 7	A, B	protein	66	Dendroaspis angusticeps	P81030 (AlphaFold model), Q8QGR0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3NEQ_1 Three-finger muscarinic toxin 7 (chains A, B)
LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKPTNVRETIRCCG
TDKCNK

Primary citation

Engineering of three-finger fold toxins creates ligands with original pharmacological profiles for muscarinic and adrenergic receptors. Fruchart-Gaillard, C., Mourier, G., Blanchet, G. et al. PLoS One (2012) 7:e39166-e39166. DOI 10.1371/journal.pone.0039166 · PubMed

Other PDB entries of the same protein (UniProt P81030 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FEV 1.3 Å, Crystal structure of the chimeric muscarinic toxin MT7 with loop 1 from MT1.
4DO8 1.8 Å, Crystal structure of the muscarinic toxin MT1

Browse structure collections

About this viewer

MolViewer shows 3NEQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.