3NKJ: HP67 L61G

Crystal Structure of HP67 L61G. Determined by X-ray diffraction at 1.6 Å resolution. Released 1 Jun 2011.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Gallus gallus
Chains: 1
Atoms: 641
Mol. weight: 7.56 kDa
Released: 1 Jun 2011

Explore 3NKJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3NKJ contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	18-21	4
α-helix	26-28	3
α-helix	38-41	4
α-helix	44-51	8
α-helix	55-60	6
α-helix	63-73	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Villin-1	A	protein	67	Gallus gallus	P02640 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3NKJ_1 Villin-1 (chains A)
PTKLETFPLDVLVNTAAEDLPRGVDPSRKENHLSDEDFKAVFGMTRSAFANGPLWKQQNL
KKEKGLF

Primary citation

Conserving the Hydrophobic Core at the Expense of Backbone Conformation in Villin Headpiece. Brown, J.W., Farelli, J.D., McKnight, C.J. To be published.

Other PDB entries of the same protein (UniProt P02640 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WY3 0.95 Å, Chicken villin subdomain HP-35, K65(NLE), N68H, pH7.0
1YRI 1.0 Å, Chicken villin subdomain HP-35, N68H, pH6.4
3TRV 1.0 Å, Crystal structure of quasiracemic villin headpiece subdomain containing (F5Phe17)…
2F4K 1.05 Å, Chicken villin subdomain HP-35, K65(NLE), N68H, K70(NLE), PH9
1YRF 1.07 Å, Chicken villin subdomain HP-35, N68H, pH6.7
5I1S 1.12 Å, Villin headpiece subdomain with a Lys30 to APC substitution
5I1N 1.3 Å, Villin headpiece subdomain with a Gln26 to beta-3-homoglutamine substitution
5I1O 1.35 Å, Villin headpiece subdomain with a Gln26 to ACPC substitution
1YU5 1.4 Å, Crystal Structure of the Headpiece Domain of Chicken Villin
2RJY 1.4 Å, Crystal structure of villin headpiece, P21 21 21 space group
5I1P 1.4 Å, Villin headpiece subdomain with a Lys30 to beta-3-homolysine substitution
1YU8 1.45 Å, Crystal Structure of the R37A Mutant of Villin Headpiece

Browse structure collections

About this viewer

MolViewer shows 3NKJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.