3NQJ: (CENP-A/H4)2 heterotetramer

Crystal structure of (CENP-A/H4)2 heterotetramer. Determined by X-ray diffraction at 2.1 Å resolution. Released 25 Aug 2010.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Homo sapiens, Homo Sapiens
Chains: 2
Atoms: 1,325
Mol. weight: 19.3 kDa
Ligands: PO4
Released: 25 Aug 2010

Explore 3NQJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3NQJ contains 7 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	64-79	16
β-strand	85-86	2	1
α-helix	88-115	28
β-strand	121	1	2
α-helix	123-133	11

Chain B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	26-28	3
α-helix	31-40	10
β-strand	46	1	2
α-helix	50-75	26
β-strand	80-81	2	1
α-helix	83-90	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone H3-like centromeric protein A	A	protein	82	Homo sapiens	P49450 (AlphaFold model)
Histone H4	B	protein	84	Homo Sapiens	P62805 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3NQJ_1 Histone H3-like centromeric protein A (chains A)
MLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGR
VTLFPKDVQLARRIRGLEEGLG

Sequence of entity 2 (B), FASTA

>3NQJ_2 Histone H4 (chains B)
MKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKR
KTVTAMDVVYALKRQGRTLYGFGG

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	4

Primary citation

The structure of (CENP-A-H4)(2) reveals physical features that mark centromeres. Sekulic, N., Bassett, E.A., Rogers, D.J. et al. Nature (2010) 467:347-351. DOI 10.1038/nature09323 · PubMed

Other PDB entries of the same protein (UniProt P49450 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CVD 1.3 Å, Crystal structure of human NRMT1 in complex with alpha-N-dimethylated human CENP-A peptide
6KDQ 1.5 Å, Crystal structure of human NRMT1 in complex with alpha-N-monomethylated human CENP-A…
6KDS 1.84 Å, Crystal structure of human NRMT2 in complex with alpha-N-monomethylated human CENP-A…
7R5R 2.44 Å, Structure of the human CCAN CENP-A alpha-satellite complex
3NQU 2.5 Å, Crystal structure of partially trypsinized (CENP-A/H4)2 heterotetramer
5ZBX 2.58 Å, The crystal structure of the nucleosome containing histone H3.1 CATD(V76Q, K77D)
3R45 2.6 Å, Structure of a CENP-A-Histone H4 Heterodimer in complex with chaperone HJURP
6E0P 2.6 Å, Cryo-EM structure of the centromeric nucleosome (Native alpha satellite DNA) in complex…
6E0C 2.63 Å, Cryo-EM structure of the CENP-A nucleosome (W601) in complex with a single chain…
3WTP 2.67 Å, Crystal Structure of the heterotypic nucleosome containing human CENP-A and H3.3
7PII 2.68 Å, Structure of the human CCAN CENP-A alpha-satellite complex
7U46 2.68 Å, Cryo-EM structure of CENP-A nucleosome (palindromic alpha satellite DNA) in complex with…

Browse structure collections

About this viewer

MolViewer shows 3NQJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.