Crystal structure of the PDZ domain of MPP7. Determined by X-ray diffraction at 1.3 Å resolution. Released 4 Aug 2010.
Explore 3O46 in 3D Show helices and sheets RCSB PDB PDBe
3O46 contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 138-144 | 7 | 1 |
| β-strand | 151-155 | 5 | 1 |
| β-strand | 162-167 | 6 | 1 |
| α-helix | 172-176 | 5 | |
| α-helix | 183 | 1 | |
| β-strand | 184-188 | 5 | 1 |
| β-strand | 191-192 | 2 | 1 |
| α-helix | 198-207 | 10 | |
| β-strand | 210-217 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| MAGUK p55 subfamily member 7 | A | protein | 93 | Homo sapiens | Q5T2T1 (AlphaFold model) |
>3O46_1 MAGUK p55 subfamily member 7 (chains A) GSDSVKIIRLVKNREPLGATIKKDEQTGAIIVARIMRGGAADRSGLIHVGDELREVNGIP VEDKRPEEIIQILAQSQGAITFKIIPGSKEETP
Crystal structure of the PDZ domain of MPP7. Nedyalkova, L., Tong, Y., Tempel, W. et al. To be published.
Other PDB entries of the same protein (UniProt Q5T2T1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3O46 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.