3LRA: PDB entry 3LRA

Structural Basis for Assembling a Human Tripartite Complex Dlg1-MPP7-Mals3. Determined by X-ray diffraction at 2.95 Å resolution. Released 17 Nov 2010.

Method: X-ray diffraction
Resolution: 2.95 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,073
Mol. weight: 29.16 kDa
Released: 17 Nov 2010

Explore 3LRA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LRA contains 17 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	5-20	16
α-helix	30-42	13
α-helix	44-55	12
α-helix	64-70	7
α-helix	79-84	6
α-helix	86-90	5
α-helix	99-106	8
α-helix	112-126	15
α-helix	129-132	4
α-helix	137-149	13
α-helix	155-163	9
α-helix	167-180	14
α-helix	186-190	5
α-helix	192-195	4
α-helix	198-217	20
α-helix	224-234	11
α-helix	236-251	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 1, MAGUK p55 subfamily member 7, Protein lin-7 homolog C	A	protein	254	Homo sapiens	Q12959 (AlphaFold model), Q5T2T1 (AlphaFold model), Q9NUP9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3LRA_1 Disks large homolog 1, MAGUK p55 subfamily member 7, Protein lin-7 homolog C (chains A)
PVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLL
DNPKLEVLFQGPGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSLVKIHEK
LHYYEKQSPVPILHGAAALADDLAEELQNKPLNSEIRELLKLLSKPNVKALLSVHDTVAQ
KNYDLEVLFQGPALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV
REVYEHVYETVDIS

Primary citation

Structural basis for tandem L27 domain-mediated polymerization. Yang, X., Xie, X., Chen, L. et al. FASEB J (2010) 24:4806-4815. DOI 10.1096/fj.10-163857 · PubMed

Other PDB entries of the same protein (UniProt Q12959 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
2X7Z 2.0 Å, Crystal Structure of the SAP97 PDZ2 I342W C378A mutant protein domain
4G69 2.0 Å, Structure of the Human Discs Large 1 PDZ2 - Adenomatous Polyposis Coli Cytoskeletal…
8CN1 2.09 Å, hDLG1-PDZ1 in complex with a TAX1 peptide from HTLV-1
3RL8 2.2 Å, Crystal structure of hDLG1-PDZ2 complexed with APC
3W9Y 2.2 Å, Crystal structure of the human DLG1 guanylate kinase domain
3RL7 2.3 Å, Crystal structure of hDLG1-PDZ1 complexed with APC
4AMH 2.3 Å, Influence of circular permutation on the folding pathway of a PDZ domain
8CN3 2.71 Å, hDLG1-PDZ2 in complex with a TAX1 peptide from HTLV-1
1PDR 2.8 Å, Crystal structure of the third PDZ domain from the human homolog of discs large protein
2M3M Solution structure of a complex consisting of hDlg/SAP-97 residues 318-406 and HPV51…
2OQS Structure of the hDLG/SAP97 PDZ2 in complex with HPV-18 papillomavirus E6 peptide

Browse structure collections

About this viewer

MolViewer shows 3LRA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.