Crystal Structure of human Hiwi1 PAZ domain (residues 277-399) in complex with 14-mer RNA (12-bp + 2-nt overhang) containing 2'-OCH3 at its 3'-end. Determined by X-ray diffraction at 2.9 Å resolution. Released 12 Jan 2011.
Explore 3O6E in 3D Show helices and sheets RCSB PDB PDBe
3O6E contains 4 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 278 | 1 | 1 |
| α-helix | 279-283 | 5 | |
| α-helix | 292-303 | 12 | |
| β-strand | 307-310 | 4 | 1 |
| β-strand | 316-318 | 3 | 1 |
| β-strand | 321-323 | 3 | 2 |
| β-strand | 331-333 | 3 | 3 |
| β-strand | 339-341 | 3 | 3 |
| α-helix | 342-348 | 7 | |
| β-strand | 361-364 | 4 | 2 |
| β-strand | 380-382 | 3 | 2 |
| α-helix | 384-386 | 3 | |
| β-strand | 387-389 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Piwi-like protein 1 | X | protein | 124 | Homo sapiens | Q96J94 (AlphaFold model) |
| RNA (5'-r(*gp*cp*gp*ap*ap*up*ap*up*up*cp*gp*cp*up*(omu))-3') | A | RNA | 14 |
>3O6E_1 Piwi-like protein 1 (chains X) SETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKA DGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPGGTLPGPAMLIPELCYLTGLTDK MRND
>3O6E_2 RNA (5'-R(*GP*CP*GP*AP*AP*UP*AP*UP*UP*CP*GP*CP*UP*(OMU))-3') (chains A) GCGAAUAUUCGCUU
Inaugural Article: Structural basis for piRNA 2'-O-methylated 3'-end recognition by Piwi PAZ (Piwi/Argonaute/Zwille) domains. Tian, Y., Simanshu, D.K., Ma, J.B. et al. Proc Natl Acad Sci U S A (2011) 108:903-910. DOI 10.1073/pnas.1017762108 · PubMed
Other PDB entries of the same protein (UniProt Q96J94 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3O6E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.