3O70: PHD finger protein 13

PHD-type zinc finger of human PHD finger protein 13. Determined by X-ray diffraction at 1.85 Å resolution. Released 29 Sept 2010.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 1
Atoms: 498
Mol. weight: 8.31 kDa
Ligands: ZN
Released: 29 Sept 2010

Explore 3O70 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3O70 contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	246-248	3	1
β-strand	255-257	3	1
α-helix	275-278	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 13	A	protein	68	Homo sapiens	Q86YI8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3O70_1 PHD finger protein 13 (chains A)
MHHHHHHSSGRENLYFQGLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFV
CQKCRDSK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

PHF13 is a molecular reader and transcriptional co-regulator of H3K4me2/3. Chung, H.R., Xu, C., Fuchs, A. et al. Elife (2016) 5. DOI 10.7554/eLife.10607 · PubMed

Other PDB entries of the same protein (UniProt Q86YI8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3O7A 1.67 Å, Crystal structure of PHF13 in complex with H3K4me3

Browse structure collections

About this viewer

MolViewer shows 3O70 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.