3O7A: PHF13

Crystal structure of PHF13 in complex with H3K4me3. Determined by X-ray diffraction at 1.67 Å resolution. Released 6 Oct 2010.

Method: X-ray diffraction
Resolution: 1.67 Å
Organisms: Homo sapiens, XENOPUS LAEVIS
Chains: 2
Atoms: 535
Mol. weight: 7.57 kDa
Ligands: ZN
Released: 6 Oct 2010

Explore 3O7A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3O7A contains 2 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	233	1	1
β-strand	240	1	1
β-strand	246-248	3	2
β-strand	255-257	3	2
α-helix	265-267	3
α-helix	275-278	4

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-4	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 13 variant	A	protein	52	Homo sapiens	Q86YI8 (AlphaFold model)
H3K4ME3 histone 11MER-peptide	B	protein	11	XENOPUS LAEVIS	Q92133 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3O7A_1 PHD finger protein 13 variant (chains A)
SWDLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDS

Sequence of entity 2 (B), FASTA

>3O7A_2 H3K4ME3 HISTONE 11MER-PEPTIDE (chains B)
ARTKQTARKST

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

PHF13 is a molecular reader and transcriptional co-regulator of H3K4me2/3. Chung, H.R., Xu, C., Fuchs, A. et al. Elife (2016) 5. DOI 10.7554/eLife.10607 · PubMed

Other PDB entries of the same protein (UniProt Q86YI8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3O70 1.85 Å, PHD-type zinc finger of human PHD finger protein 13

Browse structure collections

About this viewer

MolViewer shows 3O7A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.