3O77: Ca2+ Sensor

The structure of Ca2+ Sensor (Case-16). Determined by X-ray diffraction at 2.35 Å resolution. Released 29 Sept 2010.

Method: X-ray diffraction
Resolution: 2.35 Å
Organisms: Gallus gallus, Aequorea victoria, Homo sapiens
Chains: 1
Atoms: 3,214
Mol. weight: 46.79 kDa
Ligands: CA
Released: 29 Sept 2010

Explore 3O77 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3O77 contains 17 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	2-18	17
β-strand	25-33	9	1
β-strand	38-48	11	1
β-strand	49	1	2
β-strand	54-65	12	1
α-helix	72-75	4
β-strand	77-86	10	1
β-strand	95-105	11	1
α-helix	127-130	4
β-strand	136-146	11	1
β-strand	149-160	12	1
α-helix	161-163	3
β-strand	165-172	8	1
α-helix	181-183	3
α-helix	193-195	3
β-strand	197	1	1
α-helix	203-205	3
α-helix	207-210	4
β-strand	216-224	9	1
β-strand	229-239	11	1
β-strand	242-252	11	1
β-strand	265	1	2
α-helix	275-286	12
β-strand	295-297	3	3
α-helix	298-300	3
α-helix	301-307	7
α-helix	316-322	7
β-strand	331-333	3	3
α-helix	334-343	10
α-helix	351-361	11
β-strand	368-369	2	4
α-helix	371-381	11
α-helix	387-397	11
β-strand	405-406	2	4
α-helix	407-414	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin light chain kinase, smooth muscle,Green fluorescent protein,Green fluorescent…	A	protein	415	Gallus gallus, Aequorea victoria, Homo sapiens	P0DP24 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3O77_1 Myosin light chain kinase, smooth muscle,Green fluorescent protein,Green fluorescent protein,Calmodulin-1 (chains A)
GPGSSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNVEDGSVQLADHY
QQNTPIGDGPVLLPDNHYLSFQSVLSKDPNEKRDHMVLLEFVTAAGITLGMDELYNVDGG
SGGTGSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVP
WPTLVTTLXLKCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDT
LVNRIELKGIGFKEDGNILGHKLEYNSRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELG
TVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFD
KDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Water and common crystallization additives (CL, SO4) are not listed.

Primary citation

The structure of Ca2+ sensor Case16 reveals the mechanism of reaction to low Ca2+ concentrations. Leder, L., Stark, W., Freuler, F. et al. Sensors (Basel) (2010) 10:8143-8160. DOI 10.3390/s100908143 · PubMed

Other PDB entries of the same protein (UniProt P0DP24 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6XXF 1.7 Å, 1.7 Angstrom crystal structure of Ca/CaM:RyR2 peptide complex
6SZ5 2.23 Å, Human calmodulin bound to a peptide of human NADPH oxidase 5
8KA0 2.35 Å, Crystal structure of Vibrio vulnificus RID-dependent transforming NADase domain…
7MIR 2.5 Å, Cryo-EM structure of SidJ-SdeA-CaM reaction intermediate complex
6PLM 2.59 Å, Legionella pneumophila SidJ/ Calmodulin 2 complex
3O78 2.6 Å, The structure of Ca2+ Sensor (Case-12)
5COC 2.67 Å, Fusion protein of human calmodulin and B4 domain of protein A from staphylococcal aureus
6MUD 2.69 Å, Voltage-gated sodium channel NaV1.5 C-terminal domain in complex with Ca2+/Calmodulin
7MIS 2.8 Å, Cryo-EM structure of SidJ-SdeC-CaM reaction intermediate complex
8KA1 2.82 Å, Crystal structure of Vibrio vulnificus RID-dependent transforming NADase domain…
8K9Z 2.9 Å, Crystal structure of Vibrio vulnificus RID-dependent transforming NADase domain…
7PPO 2.91 Å, Structure of SidJ/CaM bound to SdeA in pre-glutamylation state

Browse structure collections

About this viewer

MolViewer shows 3O77 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.