The crystal structure of human interferon lambda 1 complexed with its high affinity receptor in space group P21212. Determined by X-ray diffraction at 2.16 Å resolution. Released 20 Oct 2010.
Explore 3OG4 in 3D Show helices and sheets RCSB PDB PDBe
3OG4 contains 15 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 25-42 | 18 | |
| α-helix | 60-62 | 3 | |
| α-helix | 65-67 | 3 | |
| α-helix | 68-83 | 16 | |
| α-helix | 89-110 | 22 | |
| α-helix | 126-140 | 15 | |
| α-helix | 143-156 | 14 | |
| α-helix | 157-161 | 5 | |
| α-helix | 162-168 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-17 | 8 | 1 |
| β-strand | 20-26 | 7 | 1 |
| β-strand | 36-42 | 7 | 2 |
| α-helix | 45-47 | 3 | |
| β-strand | 50-59 | 10 | 2 |
| β-strand | 63-65 | 3 | 1 |
| β-strand | 78 | 1 | 3 |
| β-strand | 80-86 | 7 | 2 |
| β-strand | 89-90 | 2 | 2 |
| α-helix | 91-93 | 3 | |
| β-strand | 94-95 | 2 | 2 |
| β-strand | 99 | 1 | 3 |
| α-helix | 101-104 | 4 | |
| α-helix | 107-110 | 4 | |
| β-strand | 111-116 | 6 | 4 |
| β-strand | 120-126 | 7 | 4 |
| β-strand | 138-146 | 9 | 5 |
| β-strand | 152-154 | 3 | 5 |
| α-helix | 155-157 | 3 | |
| β-strand | 158-159 | 2 | 5 |
| β-strand | 163-167 | 5 | 4 |
| β-strand | 175-184 | 10 | 5 |
| β-strand | 190-191 | 2 | 5 |
| α-helix | 192-197 | 6 | |
| β-strand | 198-201 | 4 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin-29 | A | protein | 178 | Homo sapiens | Q8IU54 (AlphaFold model) |
| Interleukin 28 receptor, alpha (Interferon, lambda receptor) | B | protein | 226 | Homo sapiens | Q8IU57 (AlphaFold model) |
>3OG4_1 Interleukin-29 (chains A) PTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLL QVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRP RGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
>3OG4_2 Interleukin 28 receptor, alpha (Interferon, lambda receptor) (chains B) PGRPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTK ELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEI LSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSA RTIYTFSVPKYSKFSKPTCFLLEVPEANASGSSGGSSGTSHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Crystal structure of the complex of human interferon-lambda1 with its high affinity receptor interferon-lambdaR1. Miknis, Z.J., Magracheva, E., Li, W. et al. J Mol Biol (2010) 404:650-664. DOI 10.1016/j.jmb.2010.09.068 · PubMed
Other PDB entries of the same protein (UniProt Q8IU54 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3OG4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.