The crystal structure of human interferon lambda 1 complexed with its high affinity receptor in space group P212121. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Oct 2010.
Explore 3OG6 in 3D Show helices and sheets RCSB PDB PDBe
3OG6 contains 17 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 25-42 | 18 | |
| α-helix | 60-62 | 3 | |
| α-helix | 65-67 | 3 | |
| α-helix | 68-86 | 19 | |
| α-helix | 92-110 | 19 | |
| α-helix | 126-140 | 15 | |
| α-helix | 143-156 | 14 | |
| α-helix | 157-161 | 5 | |
| α-helix | 162-167 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-7 | 3 | |
| β-strand | 8-15 | 8 | 1 |
| β-strand | 18-24 | 7 | 1 |
| β-strand | 34-40 | 7 | 2 |
| β-strand | 48-50 | 3 | 2 |
| α-helix | 52-54 | 3 | |
| β-strand | 57 | 1 | 2 |
| β-strand | 61-63 | 3 | 1 |
| β-strand | 76 | 1 | 3 |
| β-strand | 78-84 | 7 | 2 |
| β-strand | 87-88 | 2 | 2 |
| α-helix | 89-91 | 3 | |
| β-strand | 92-93 | 2 | 2 |
| α-helix | 94-96 | 3 | |
| β-strand | 97 | 1 | 3 |
| α-helix | 99-102 | 4 | |
| α-helix | 105-108 | 4 | |
| β-strand | 109-115 | 7 | 4 |
| β-strand | 118-124 | 7 | 4 |
| β-strand | 136-144 | 9 | 5 |
| β-strand | 151-152 | 2 | 5 |
| α-helix | 153-155 | 3 | |
| β-strand | 156-157 | 2 | 5 |
| β-strand | 161-165 | 5 | 4 |
| β-strand | 173-183 | 11 | 5 |
| β-strand | 187-189 | 3 | 5 |
| α-helix | 190-195 | 6 | |
| β-strand | 196-199 | 4 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin-29 | A | protein | 196 | Homo sapiens | Q8IU54 (AlphaFold model) |
| Interleukin 28 receptor, alpha (Interferon, lambda receptor) | B | protein | 226 | Homo sapiens | Q8IU57 (AlphaFold model) |
>3OG6_1 Interleukin-29 (chains A) HHHHHHDYKDDDDKADPVPTSKPTPTGKGCHIGRFKSLSPQELASFKKARDALEESLKLK NWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHI LSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYV ADGNLCLRTSTHPEST
>3OG6_2 Interleukin 28 receptor, alpha (Interferon, lambda receptor) (chains B) PGRPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTK ELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEI LSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSA RTIYTFSVPKYSKFSKPTCFLLEVPEANASGSSGGSSGTSHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Water and common crystallization additives (GOL) are not listed.
Crystal structure of the complex of human interferon-lambda1 with its high affinity receptor interferon-lambdaR1. Miknis, Z.J., Magracheva, E., Li, W. et al. J Mol Biol (2010) 404:650-664. DOI 10.1016/j.jmb.2010.09.068 · PubMed
Other PDB entries of the same protein (UniProt Q8IU54 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3OG6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.