Crystal structure of the Prototype Foamy Virus (PFV) intasome in complex with magnesium and raltegravir at 2.65 resolution. Determined by X-ray diffraction at 2.65 Å resolution. Released 20 Oct 2010.
Explore 3OYA in 3D Show helices and sheets RCSB PDB PDBe
3OYA contains 37 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-16 | 8 | |
| β-strand | 30-33 | 4 | 1 |
| β-strand | 36-41 | 6 | 1 |
| β-strand | 44-47 | 4 | 1 |
| α-helix | 51-63 | 13 | |
| α-helix | 69-77 | 9 | |
| β-strand | 80 | 1 | 1 |
| α-helix | 85-93 | 9 | |
| α-helix | 97-102 | 6 | |
| α-helix | 104-105 | 2 | |
| β-strand | 108-109 | 2 | 2 |
| α-helix | 110-113 | 4 | |
| α-helix | 115-118 | 4 | |
| β-strand | 124-130 | 7 | 3 |
| β-strand | 136 | 1 | 4 |
| β-strand | 139 | 1 | 4 |
| β-strand | 141-147 | 7 | 3 |
| β-strand | 153-158 | 6 | 3 |
| α-helix | 163-173 | 11 | |
| β-strand | 181-184 | 4 | 3 |
| α-helix | 188-191 | 4 | |
| α-helix | 193-200 | 8 | |
| α-helix | 204 | 1 | |
| β-strand | 205-208 | 4 | 3 |
| α-helix | 209-210 | 2 | |
| α-helix | 214-217 | 4 | |
| α-helix | 218-235 | 18 | |
| α-helix | 246-254 | 9 | |
| β-strand | 258 | 1 | 5 |
| β-strand | 263 | 1 | 5 |
| α-helix | 265-270 | 6 | |
| α-helix | 288-300 | 13 | |
| α-helix | 308-311 | 4 | |
| β-strand | 314-315 | 2 | 2 |
| β-strand | 322-325 | 4 | 6 |
| β-strand | 326 | 1 | 7 |
| α-helix | 327 | 1 | |
| α-helix | 330-331 | 2 | |
| β-strand | 337 | 1 | 7 |
| α-helix | 338-340 | 3 | |
| β-strand | 341-348 | 8 | 6 |
| β-strand | 351-355 | 5 | 6 |
| β-strand | 361-365 | 5 | 6 |
| α-helix | 366-368 | 3 | |
| β-strand | 369-371 | 3 | 6 |
| α-helix | 372 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 117-119 | 3 | |
| β-strand | 124-130 | 7 | 8 |
| β-strand | 136 | 1 | 9 |
| β-strand | 139 | 1 | 9 |
| β-strand | 141-147 | 7 | 8 |
| β-strand | 153-158 | 6 | 8 |
| α-helix | 163-173 | 11 | |
| β-strand | 181-184 | 4 | 8 |
| α-helix | 188-191 | 4 | |
| α-helix | 193-201 | 9 | |
| α-helix | 204 | 1 | |
| β-strand | 205-208 | 4 | 8 |
| α-helix | 209-210 | 2 | |
| α-helix | 218-235 | 18 | |
| α-helix | 243-245 | 3 | |
| α-helix | 246-254 | 9 | |
| α-helix | 256-258 | 3 | |
| α-helix | 265-270 | 6 | |
| α-helix | 286-287 | 2 | |
| α-helix | 288-297 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PFV integrase | A, B | protein | 395 | Human spumaretrovirus | P14350 |
| DNA (5'-d(*ap*tp*tp*gp*tp*cp*ap*tp*gp*gp*ap*ap*tp*tp*tp*cp*gp*cp*a)-3') | C | DNA | 19 | ||
| DNA (5'-d(*tp*gp*cp*gp*ap*ap*ap*tp*tp*cp*cp*ap*tp*gp*ap*cp*a)-3') | D | DNA | 17 |
>3OYA_1 PFV integrase (chains A, B) GPGCNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKI VLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDR PQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIA IPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVG RPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQE IRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDH LGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
>3OYA_2 DNA (5'-D(*AP*TP*TP*GP*TP*CP*AP*TP*GP*GP*AP*AP*TP*TP*TP*CP*GP*CP*A)-3') (chains C) ATTGTCATGGAATTTCGCA
>3OYA_3 DNA (5'-D(*TP*GP*CP*GP*AP*AP*AP*TP*TP*CP*CP*AP*TP*GP*AP*CP*A)-3') (chains D) TGCGAAATTCCATGACA
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
| MG | Magnesium ion | Mg | 3 |
| RLT | N-(4-fluorobenzyl)-5-hydroxy-1-methyl-2-(1-methyl-1-{[(5-methyl-1,3,4-oxadiazol… | C20 H21 F N6 O5 | 1 |
Water and common crystallization additives (NH4, GOL, SO4) are not listed.
Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance. Hare, S., Vos, A.M., Clayton, R.F. et al. Proc Natl Acad Sci U S A (2010) 107:20057-20062. DOI 10.1073/pnas.1010246107 · PubMed
Other PDB entries of the same protein (UniProt P14350), best resolution first:
3OYA is part of these collections:
MolViewer shows 3OYA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.