3P8F: MT-SP1

Crystal Structure of MT-SP1 in complex with SFTI-1. Determined by X-ray diffraction at 2.0 Å resolution. Released 10 Aug 2011.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Homo sapiens, Helianthus annuus
Chains: 2
Atoms: 2,090
Mol. weight: 28.32 kDa
Ligands: GSH
Released: 10 Aug 2011

Explore 3P8F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3P8F contains 9 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-35	6	3
β-strand	39-46	8	3
β-strand	51-54	4	3
α-helix	56-59	4
β-strand	60B	1	4
β-strand	60E	1	4
α-helix	61-63	3
β-strand	64-68	5	3
β-strand	72	1	5
β-strand	81-90	10	3
β-strand	104-108	5	3
α-helix	120-121	2
β-strand	122	1	2
α-helix	123-125	3
β-strand	135-140	6	2
β-strand	154	1	5
β-strand	156-162	7	2
α-helix	165-171	7
β-strand	180-184	5	2
β-strand	189	1	1
α-helix	197	1
β-strand	198-202	5	2
β-strand	207-217	11	2
β-strand	226-230	5	2
α-helix	232-234	3
α-helix	235-242	8

Chain I: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	2
β-strand	11	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ST14 protein	A	protein	241	Homo sapiens	Q9Y5Y6 (AlphaFold model)
Trypsin inhibitor 1	I	protein	14	Helianthus annuus	Q4GWU5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3P8F_1 ST14 protein (chains A)
VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTA
FLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPD
ASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFL
SGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTG
V

Sequence of entity 2 (I), FASTA

>3P8F_2 Trypsin inhibitor 1 (chains I)
GRCTKSIPPICFPD

Ligands and cofactors

ID	Name	Formula	Copies
GSH	Glutathione	C10 H17 N3 O6 S	1

Primary citation

Structure of catalytic domain of Matriptase in complex with Sunflower trypsin inhibitor-1. Yuan, C., Chen, L., Meehan, E.J. et al. BMC Struct Biol (2011) 11:30-30. DOI 10.1186/1472-6807-11-30 · PubMed

Other PDB entries of the same protein (UniProt Q9Y5Y6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NCL 1.19 Å, Crystal Structure of MT-SP1 bound to Benzamidine Phosphonate Inhibitor
3P8G 1.2 Å, Crystal Structure of MT-SP1 in complex with benzamidine
8G1W 1.2 Å, Crystal Structure Matriptase (C731S) in Complex with Inhibitor VD4162B
1EAX 1.3 Å, Crystal structure of MTSP1 (matriptase)
8G1V 1.35 Å, Crystal Structure Matriptase (C731S) in Complex with Inhibitor MM1132-2
4IS5 1.48 Å, Crystal Structure of the ligand-free inactive Matriptase
3NPS 1.5 Å, Crystal structure of membrane-type serine protease 1 (MT-SP1) in complex with the Fab…
6T9T 1.69 Å, Matriptase in complex with the synthetic inhibitor (S)-3-(3-(4-(3-(tert-butyl)ureido)pipe…
4JZ1 1.9 Å, Crystal Structure of Matriptase in complex with Inhibitor
4O9V 1.9 Å, Crystal structure of matriptase in complex with inhibitor
4R0I 1.9 Å, Crystal structure of matriptase in complex with inhibitor
6N4T 1.95 Å, Crystal structure of Matriptase1 in complex with a peptidomimetic benzothiazole

Browse structure collections

About this viewer

MolViewer shows 3P8F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.