3PGE: Sumoylated PCNA

Structure of sumoylated PCNA. Determined by X-ray diffraction at 2.8 Å resolution. Released 29 Dec 2010.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,647
Mol. weight: 42.03 kDa
Released: 29 Dec 2010

Explore 3PGE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PGE contains 10 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	24-29	6	1
β-strand	34-39	6	1
α-helix	46-56	11
α-helix	60-62	3
β-strand	63-67	5	1
β-strand	70-71	2	1
β-strand	87-93	7	1
β-strand	103-108	6	2
β-strand	113-118	6	2
β-strand	121	1	3
β-strand	131	1	3
β-strand	132-135	4	4
β-strand	139-144	6	2
α-helix	145-151	7
α-helix	152-157	6
β-strand	160-165	6	4
α-helix	170	1
β-strand	171-177	7	4
β-strand	180-186	7	4
α-helix	187-189	3

Chain B: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	5
α-helix	9-19	11
β-strand	25-31	7	4
β-strand	34-40	7	4
β-strand	46-53	8	4
α-helix	54-56	3
β-strand	57-62	6	5
β-strand	66-71	6	4
α-helix	72-78	7
β-strand	87-92	6	5
β-strand	98-104	7	5
β-strand	111-117	7	5
β-strand	119	1	4
β-strand	135-140	6	4
α-helix	141-151	11
β-strand	157-162	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SUMO-modified proliferating cell nuclear antigen	A	protein	200	Saccharomyces cerevisiae	P15873 (AlphaFold model), Q12306 (AlphaFold model)
Proliferating cell nuclear antigen	B	protein	171	Saccharomyces cerevisiae	P15873 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3PGE_1 SUMO-modified proliferating cell nuclear antigen (chains A)
HHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAK
RQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGGETIKFVADGDIGSG
SVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQ
FDLKSGFLQFFLAPKFNDEE

Sequence of entity 2 (B), FASTA

>3PGE_2 Proliferating cell nuclear antigen (chains B)
DYKDDDDKMLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEI
GVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIA
EYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMIT

Primary citation

Crystal Structure of SUMO-Modified Proliferating Cell Nuclear Antigen. Freudenthal, B.D., Brogie, J.E., Gakhar, L. et al. J Mol Biol (2011) 406:9-17. DOI 10.1016/j.jmb.2010.12.015 · PubMed

Other PDB entries of the same protein (UniProt P15873 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5V7M 1.93 Å, PCNA mutant L126A/I128A Protein Defective in Gene Silencing
8DQX 2.1 Å, Open state of RFC:PCNA bound to a 3' ss/dsDNA junction
8DR1 2.14 Å, Consensus closed state of RFC:PCNA bound to a 3' ss/dsDNA junction (DNA2)
8DR3 2.2 Å, Closed state of RFC:PCNA bound to a 3' ss/dsDNA junction (DNA2) with NTD
1PLQ 2.3 Å, Crystal structure of the eukaryotic DNA polymerase processivity factor pcna
8DR6 2.39 Å, Closed state of RFC:PCNA bound to a nicked dsDNA
8DR0 2.42 Å, Closed state of RFC:PCNA bound to a 3' ss/dsDNA junction
8DR4 2.45 Å, Open state of RFC:PCNA bound to a 3' ss/dsDNA junction (DNA2) without NTD
3GPN 2.5 Å, Structure of the non-trimeric form of the E113G PCNA mutant protein
3V60 2.6 Å, Structure of S. cerevisiae PCNA conjugated to SUMO on lysine 164
8THW 2.6 Å, Cac1 PIP motif bound to PCNA
6W9W 2.65 Å, R80A PCNA mutant defective in BIR

Browse structure collections

About this viewer

MolViewer shows 3PGE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.