The structure of yeast phosphoglycerate mutase at 0.28 nm resolution. Determined by X-ray diffraction at 2.8 Å resolution. Released 26 May 1982.
Explore 3PGM in 3D Show helices and sheets RCSB PDB PDBe
3PGM contains 20 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-5 | 2 | 1 |
| β-strand | 7 | 1 | 2 |
| α-helix | 14-17 | 4 | |
| α-helix | 29-40 | 12 | |
| α-helix | 41-45 | 5 | |
| β-strand | 51-55 | 5 | 1 |
| α-helix | 58-71 | 14 | |
| β-strand | 79-81 | 3 | 1 |
| α-helix | 99-103 | 5 | |
| α-helix | 107-111 | 5 | |
| α-helix | 154-161 | 8 | |
| α-helix | 162-166 | 5 | |
| α-helix | 167-169 | 3 | |
| β-strand | 174-176 | 3 | 1 |
| α-helix | 182-190 | 9 | |
| β-strand | 205 | 1 | 2 |
| β-strand | 209-210 | 2 | 1 |
| β-strand | 224 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphoglycerate mutase 1 | A, B | protein | 244 | Saccharomyces cerevisiae | P00950 (AlphaFold model) |
>3PGM_1 Phosphoglycerate mutase 1 (chains A, B) PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKGVNVLVDYTSKLSRA IQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAQTLKKFGEEKFNTYRRSFDVPP PPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKLVGKTSMIAAHG NSLRGLVKHLEGISDADIAKLNIPPGTILVFELDENLKPSKPSYYLDPEAAAAGAAAVAN QGKK
| ID | Name | Formula | Copies |
|---|---|---|---|
| 3PG | 3-phosphoglyceric acid | C3 H7 O7 P | 2 |
Water and common crystallization additives (SO4) are not listed.
Structure and activity of phosphoglycerate mutase. Winn, S.I., Watson, H.C., Harkins, R.N. et al. Philos Trans R Soc London,ser B (1981) 293:121-130. PubMed
Other PDB entries of the same protein (UniProt P00950 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3PGM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.