3POM: Unliganded Retinoblastoma Protein Pocket Domain

Crystal Structure of the Unliganded Retinoblastoma Protein Pocket Domain. Determined by X-ray diffraction at 2.5 Å resolution. Released 27 Apr 2011.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,731
Mol. weight: 82.43 kDa
Released: 27 Apr 2011

Explore 3POM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3POM contains 46 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	384-391	8
α-helix	396-397	2
α-helix	398-405	8
α-helix	412-434	23
α-helix	440-468	29
α-helix	474-478	5
α-helix	480-498	19
α-helix	516-520	5
α-helix	525-538	14
α-helix	544-559	16
α-helix	561-563	3
α-helix	568-578	11
α-helix	645-669	25
α-helix	676-690	15
α-helix	692-695	4
α-helix	700-714	15
α-helix	721-728	8
α-helix	737-740	4
β-strand	742-743	2	1
β-strand	749-750	2	1
α-helix	752-755	4
α-helix	756-760	5
α-helix	761-769	9
α-helix	770-772	3
α-helix	776-784	9

Chain B: 23 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	383-390	8
α-helix	398-405	8
α-helix	412-434	23
α-helix	436-438	3
α-helix	439-468	30
α-helix	474-477	4
α-helix	480-499	20
α-helix	516-520	5
α-helix	525-538	14
α-helix	544-559	16
α-helix	561-563	3
α-helix	569-576	8
α-helix	645-668	24
α-helix	676-690	15
α-helix	692-695	4
α-helix	700-714	15
α-helix	721-728	8
α-helix	737-740	4
β-strand	742-743	2	2
β-strand	749-750	2	2
α-helix	752-755	4
α-helix	756-760	5
α-helix	761-768	8
α-helix	769-771	3
α-helix	779-784	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinoblastoma-associated protein	A, B	protein	352	Homo sapiens	P06400 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3POM_1 Retinoblastoma-associated protein (chains A, B)
GEFNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQ
GCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMA
TYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHR
IMESLAWLSDSPLFDLIKQSKLVPRGSKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPE
LEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAV
QETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR

Primary citation

Crystal structure of the unliganded retinoblastoma protein pocket domain. Balog, E.R., Burke, J.R., Hura, G.L. et al. Proteins (2011) 79:2010-2014. DOI 10.1002/prot.23007 · PubMed

Other PDB entries of the same protein (UniProt P06400 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2R7G 1.67 Å, Structure of the retinoblastoma protein pocket domain in complex with adenovirus E1A CR1…
1GUX 1.85 Å, Rb pocket bound to E7 lxcxe motif
4ELL 1.98 Å, Structure of the inactive retinoblastoma protein pocket domain
2QDJ 2.0 Å, Crystal structure of the Retinoblastoma protein N-domain provides insight into tumor…
9DHU 2.16 Å, The Retinoblastoma Protein with Mutation E533K
1N4M 2.2 Å, Structure of Rb tumor suppressor bound to the transactivation domain of E2F-2
9DHF 2.26 Å, The Retinoblastoma Protein with Mutation E554K
1AD6 2.3 Å, Domain A of human retinoblastoma tumor suppressor
9DHC 2.32 Å, The Retinoblastoma Protein with Mutation S751Y
4CRI 2.35 Å, Crystal Structure of 53BP1 tandem tudor domains in complex with methylated K810 Rb peptide
9DGK 2.38 Å, The Retinoblastoma Protein with Mutation M704V
1H25 2.5 Å, CDK2/Cyclin A in complex with an 11-residue recruitment peptide from…

Browse structure collections

About this viewer

MolViewer shows 3POM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.