3PPX: N1602A mutant of an engineered VWF A2 domain

Crystal structure of the N1602A mutant of an engineered VWF A2 domain (N1493C and C1670S). Determined by X-ray diffraction at 1.91 Å resolution. Released 4 May 2011.

Method: X-ray diffraction
Resolution: 1.91 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,579
Mol. weight: 22.04 kDa
Released: 4 May 2011

Explore 3PPX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PPX contains 10 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	1497-1504	8	1
β-strand	1506	1	2
α-helix	1511-1527	17
β-strand	1530	1	1
β-strand	1535-1542	8	1
β-strand	1546-1550	5	1
α-helix	1558-1566	9
α-helix	1568-1570	3
β-strand	1573	1	2
α-helix	1578-1584	7
α-helix	1585-1589	5
α-helix	1592-1594	3
β-strand	1602-1608	7	1
α-helix	1618-1620	3
β-strand	1623-1630	8	1
α-helix	1636-1643	8
α-helix	1647-1648	2
β-strand	1649-1651	3	1
α-helix	1657-1671	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
von Willebrand factor	A	protein	196	Homo sapiens	P04275 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3PPX_1 von Willebrand factor (chains A)
MLGPKRCSMVLDVAFVLEGSDKIGEADFNRSKEFMEEVIQRMDVGQDSIHVTVLQYSYMV
TVEYPFSEAQSKGDILQRVREIRYQGGNRTNTGLALRYLSDHSFLVSQGDREQAPALVYM
VTGNPASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVL
QRCSSGEGLEHHHHHH

Primary citation

A novel calcium-binding site of von Willebrand factor A2 domain regulates its cleavage by ADAMTS13. Zhou, M., Dong, X., Baldauf, C. et al. Blood (2011) 117:4623-4631. DOI 10.1182/blood-2010-11-321596 · PubMed

Other PDB entries of the same protein (UniProt P04275 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BV8 1.59 Å, G1324S mutation in von Willebrand Factor A1 domain
7EOW 1.6 Å, High-resolution structure of vWF A1 domain in complex with caplacizumab, the first…
3ZQK 1.7 Å, Von Willebrand Factor A2 domain with calcium
1ATZ 1.8 Å, Human von willebrand factor A3 domain
1IJB 1.8 Å, The von Willebrand Factor mutant (I546V) A1 domain
2ADF 1.9 Å, Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody…
3GXB 1.9 Å, Crystal structure of VWF A2 domain
3PPV 1.9 Å, Crystal structure of an engineered VWF A2 domain (N1493C and C1670S)
3PPW 1.9 Å, Crystal structure of the D1596A mutant of an engineered VWF A2 domain (N1493C and C1670S)
1FNS 2.0 Å, Crystal structure of the von willebrand factor (VWF) A1 domain I546V mutant in complex…
3PPY 2.0 Å, Crystal structure of the D1596A/N1602A double mutant of an engineered VWF A2 domain…
1FE8 2.03 Å, Crystal structure of the von willebrand factor A3 domain in complex with a FAB fragment…

Browse structure collections

About this viewer

MolViewer shows 3PPX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.