3PRY: Middle domain of human HSP90-beta

Crystal structure of the middle domain of human HSP90-beta refined at 2.3 A resolution. Determined by X-ray diffraction at 2.28 Å resolution. Released 15 Dec 2010.

Method: X-ray diffraction
Resolution: 2.28 Å
Organism: Homo sapiens
Chains: 3
Atoms: 6,396
Mol. weight: 96.09 kDa
Released: 15 Dec 2010

Explore 3PRY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PRY contains 39 α-helices and 38 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	288-290	3
α-helix	293-295	3
α-helix	298-309	12
β-strand	317-323	7	1
β-strand	329-335	7	1
β-strand	353-357	5	1
β-strand	360-363	4	1
α-helix	367-369	3
α-helix	372-374	3
β-strand	378-383	6	1
α-helix	395-420	26
α-helix	423-443	21
α-helix	445-447	3
α-helix	448-453	6
β-strand	456-457	2	2
β-strand	458-459	2	3
β-strand	467-468	2	2
α-helix	469-474	6
β-strand	482-486	5	3
α-helix	491-495	5
α-helix	498-504	7
β-strand	510-512	3	3
α-helix	518-525	8
β-strand	527-528	2	3
β-strand	531-535	5	3

Chain B: 13 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	288-290	3
α-helix	293-295	3
α-helix	298-309	12
α-helix	314-315	2
β-strand	317-323	7	4
β-strand	329-335	7	4
β-strand	353-357	5	4
β-strand	360-363	4	4
α-helix	367-369	3
α-helix	372-374	3
β-strand	378-383	6	4
α-helix	399-419	21
α-helix	423-443	21
α-helix	448-452	5
β-strand	457	1	5
β-strand	458-459	2	6
β-strand	467	1	5
α-helix	469-474	6
β-strand	483-487	5	6
α-helix	491-495	5
α-helix	498-505	8
β-strand	510-513	4	6
α-helix	518-525	8
β-strand	527-528	2	7
β-strand	531-532	2	7
β-strand	533-535	3	6

Chain C: 13 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	288-290	3
α-helix	293-295	3
α-helix	298-309	12
α-helix	314-315	2
β-strand	317-323	7	8
β-strand	329-335	7	8
β-strand	353-357	5	8
β-strand	361-363	3	8
α-helix	367-369	3
β-strand	378-383	6	8
α-helix	394-419	26
α-helix	423-443	21
α-helix	445-447	3
α-helix	448-454	7
β-strand	456-457	2	9
β-strand	459	1	10
β-strand	467-468	2	9
α-helix	469-474	6
β-strand	483-487	5	10
α-helix	491-495	5
α-helix	498-505	8
β-strand	510-513	4	10
α-helix	517-525	9
β-strand	527-528	2	11
β-strand	531-532	2	11
β-strand	533-535	3	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein HSP 90-beta	A, B, C	protein	268	Homo sapiens	P08238 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>3PRY_1 Heat shock protein HSP 90-beta (chains A, B, C)
MKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFD
LFENKKKKNNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILK
VIRKNIVKKCLELFSELAEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQS
GDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCV
QQLKEFDGKSLVSVTKEGLELAENLYFQ

Primary citation

Crystal structure of the middle domain of human HSP90-beta refined at 2.3 A resolution. Chaikuad, A., Pilka, E., Sharpe, T.D. et al. To be published.

Other PDB entries of the same protein (UniProt P08238 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9D9I 1.5 Å, Human Hsp90b nucleotide binding domain in complex with BRI2312
6N8Y 1.55 Å, Hsp90-beta bound to PU-11-trans
5UCJ 1.69 Å, Hsp90b N-terminal domain with inhibitors
7ULJ 1.82 Å, Hsp90b N-terminal domain in complex with 42C
9D9H 1.96 Å, Human Hsp90b nucleotide binding domain in complex with BRI2311
5UC4 2.05 Å, Hsp90b N-terminal domain with inhibitors
3FWV 2.2 Å, Crystal Structure of a Redesigned TPR Protein, T-MOD(VMY), in Complex with MEEVF Peptide
3NMQ 2.2 Å, Hsp90b N-terminal domain in complex with EC44, a pyrrolo-pyrimidine methoxypyridine…
1UYM 2.45 Å, Human Hsp90-beta with PU3 (9-Butyl-8(3,4,5-trimethoxy-benzyl)-9H-purin-6-ylamine)
3UQ3 2.6 Å, TPR2AB-domain:pHSP90-complex of yeast Sti1
9W5I 2.63 Å, AGO maturation complex (AMC): AGO2-miRNA duplex in complex with Hsp90 beta and…
5UCH 2.65 Å, Hsp90b N-terminal domain with inhibitors

Browse structure collections

About this viewer

MolViewer shows 3PRY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.