3FWV: Redesigned TPR Protein, T-MOD(VMY)

Crystal Structure of a Redesigned TPR Protein, T-MOD(VMY), in Complex with MEEVF Peptide. Determined by X-ray diffraction at 2.2 Å resolution. Released 21 Apr 2009.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Homo sapiens, synthetic construct
Chains: 4
Atoms: 2,321
Mol. weight: 32 kDa
Ligands: NI
Released: 21 Apr 2009

Explore 3FWV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FWV contains 14 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	223-237	15
α-helix	241-254	14
α-helix	260-272	13
α-helix	275-291	17
α-helix	296-312	17
α-helix	316-329	14
α-helix	333-347	15

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	223-237	15
α-helix	241-254	14
α-helix	260-271	12
α-helix	275-291	17
α-helix	296-313	18
α-helix	316-330	15
α-helix	333-347	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hsc70/Hsp90-organizing protein	A, B	protein	128	Homo sapiens	P31948 (AlphaFold model)
Heat shock protein HSP 90-beta	C, D	protein	6	synthetic construct	P08238 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3FWV_1 Hsc70/Hsp90-organizing protein (chains A, B)
SKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCREL
CEKAIEVGRENREDYRMIAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQ
AEKILKEQ

Sequence of entity 2 (C, D), FASTA

>3FWV_2 Heat shock protein HSP 90-beta (chains C, D)
XMEEVF

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	4

Primary citation

Redesign of a protein-peptide interaction: characterization and applications. Jackrel, M.E., Valverde, R., Regan, L. Protein Sci (2009) 18:762-774. DOI 10.1002/pro.75 · PubMed

Other PDB entries of the same protein (UniProt P31948 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ELW 1.6 Å, Crystal structure of the TPR1 domain of HOP in complex with a HSC70 peptide
1ELR 1.9 Å, Crystal structure of the TPR2A domain of HOP in complex with the HSP90 peptide MEEVD
3ESK 2.05 Å, Structure of HOP TPR2A domain in complex with the non-cognate Hsc70 peptide ligand
9QQU 2.13 Å, Crystal structure of an engineered TPR domain in complex with the HSP90 peptide MEEVD
7KW7 3.57 Å, Atomic cryoEM structure of Hsp90-Hsp70-Hop-GR
2LNI Solution NMR Structure of Stress-induced-phosphoprotein 1 STI1 from Homo sapiens,…
2NC9 Apo solution structure of Hop TPR2A

Browse structure collections

About this viewer

MolViewer shows 3FWV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.