Human Hsp90b nucleotide binding domain in complex with BRI2311. Determined by X-ray diffraction at 1.96 Å resolution. Released 10 Sept 2025.
Explore 9D9H in 3D Show helices and sheets RCSB PDB PDBe
9D9H contains 11 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13-16 | 4 | 1 |
| α-helix | 17-18 | 2 | |
| α-helix | 19-30 | 12 | |
| α-helix | 38-58 | 21 | |
| α-helix | 62-65 | 4 | |
| β-strand | 73-78 | 6 | 1 |
| β-strand | 83-88 | 6 | 1 |
| α-helix | 95-96 | 2 | |
| α-helix | 97-101 | 5 | |
| α-helix | 102-118 | 17 | |
| α-helix | 123-129 | 7 | |
| α-helix | 132-138 | 7 | |
| β-strand | 140-148 | 9 | 1 |
| β-strand | 155-159 | 5 | 1 |
| β-strand | 164-169 | 6 | 1 |
| β-strand | 178-185 | 8 | 1 |
| α-helix | 187-193 | 7 | |
| α-helix | 195-205 | 11 | |
| β-strand | 213-215 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heat shock protein HSP 90-beta | A | protein | 224 | Homo sapiens | P08238 (AlphaFold model) |
>9D9H_1 Heat shock protein HSP 90-beta (chains A) GMPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESL TDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQA GADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGT KVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREK
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1A26 | (1P)-3-amino-6-[({1-[(2S)-2-(2,4-difluorophenyl)-2-hydroxy-3-(1H-1,2,4-triazol-… | C37 H37 F2 N9 O3 S | 1 |
Water and common crystallization additives (CL) are not listed.
Final Title 'To Be Determined'. Kuntz, D.A., Prive, G.G. To be published.
Other PDB entries of the same protein (UniProt P08238 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9D9H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.